Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G29090 91 / 8e-24 PME31, ATPME31 A. THALIANA PECTIN METHYLESTERASE 31, pectin methylesterase 31 (.1) AT3G17060 61 / 7e-13 Pectin lyase-like superfamily protein (.1) AT5G47500 61 / 9e-13 PME5 pectin methylesterase 5, Pectin lyase-like superfamily protein (.1) AT5G55590 60 / 2e-12 QRT1 QUARTET 1, Pectin lyase-like superfamily protein (.1) AT2G47030 59 / 5e-12 VGDH1 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G06830 58 / 1e-11 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT2G47040 58 / 1e-11 VGD1 VANGUARD1, Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT5G07430 55 / 8e-11 Pectin lyase-like superfamily protein (.1) AT2G21610 55 / 1e-10 PE11, ATPE11 A. THALIANA PECTINESTERASE 11, pectinesterase 11 (.1) AT5G61680 54 / 2e-10 Pectin lyase-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041699 [exp] 125 / 4e-37 AT3G29090 527 / 0.0 A. THALIANA PECTIN METHYLESTERASE 31, pectin methylesterase 31 (.1) Lus10014338 [exp] 107 / 3e-30 AT3G29090 545 / 0.0 A. THALIANA PECTIN METHYLESTERASE 31, pectin methylesterase 31 (.1) Lus10026047 [exp] 105 / 2e-29 AT3G29090 548 / 0.0 A. THALIANA PECTIN METHYLESTERASE 31, pectin methylesterase 31 (.1) Lus10026347 [exp] 63 / 2e-13 AT2G21610 399 / 2e-139 A. THALIANA PECTINESTERASE 11, pectinesterase 11 (.1) Lus10040541 [exp] 62 / 6e-13 AT3G17060 471 / 7e-168 Pectin lyase-like superfamily protein (.1) Lus10023560 [exp] 61 / 1e-12 AT2G21610 368 / 4e-127 A. THALIANA PECTINESTERASE 11, pectinesterase 11 (.1) Lus10016605 [exp] 60 / 2e-12 AT5G55590 409 / 3e-142 QUARTET 1, Pectin lyase-like superfamily protein (.1) Lus10000045 [exp] 59 / 2e-12 AT2G21610 214 / 8e-69 A. THALIANA PECTINESTERASE 11, pectinesterase 11 (.1) Lus10012942 [exp] 57 / 2e-11 AT5G19730 594 / 0.0 Pectin lyase-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G128820 [exp] 99 / 6e-27 AT3G29090 562 / 0.0 A. THALIANA PECTIN METHYLESTERASE 31, pectin methylesterase 31 (.1) Potri.014G117100 [exp] 68 / 3e-15 AT5G19730 320 / 3e-107 Pectin lyase-like superfamily protein (.1) Potri.004G156300 [exp] 62 / 3e-13 AT2G21610 457 / 3e-162 A. THALIANA PECTINESTERASE 11, pectinesterase 11 (.1) Potri.008G104800 [exp] 61 / 1e-12 AT3G17060 477 / 5e-170 Pectin lyase-like superfamily protein (.1) Potri.018G068400 [exp] 59 / 4e-12 AT5G19730 603 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.001G365700 [exp] 57 / 2e-11 AT5G55590 429 / 1e-149 QUARTET 1, Pectin lyase-like superfamily protein (.1) Potri.006G186000 [exp] 55 / 1e-10 AT1G69940 412 / 4e-144 Pectin lyase-like superfamily protein (.1) Potri.006G186100 [exp] 55 / 1e-10 AT1G69940 412 / 4e-144 Pectin lyase-like superfamily protein (.1) Potri.001G162400 [exp] 55 / 1e-10 AT3G14310 792 / 0.0 pectin methylesterase 3 (.1) Potri.012G114900 [exp] 54 / 2e-10 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [flax] [poplar] Pec_lyase-like PF01095 [flax] [poplar] Pectinesterase Pectinesterase
Representative CDS sequence Show only first row Show all	>Lus10024049 pacid=23141546 polypeptide=Lus10024049 locus=Lus10024049.g ID=Lus10024049.BGIv1.0 annot-version=v1.0 ATGGCGGGCCTAGTAATAACGGTGGCACAGGACGGCACCGGCGACTTCACCACCGTCCAGGAAGCAGTCGACGCCGTCCCCTTCGGCAATAACGTCCGGA TCATAATCCACGTTTGCCCTGGGGTTTACAGGCAGCCTGTTTACGTTCCCAAGACTAGAAACTTCATAACCCTGGCAGGTTTAAGCCCCTGA
AA sequence Show only first row Show all	>Lus10024049 pacid=23141546 polypeptide=Lus10024049 locus=Lus10024049.g ID=Lus10024049.BGIv1.0 annot-version=v1.0 MAGLVITVAQDGTGDFTTVQEAVDAVPFGNNVRIIIHVCPGVYRQPVYVPKTRNFITLAGLSP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G29090		PME31, ATPME31	A. THALIANA PECTIN METHYLESTER...		Lus10024049 [exp]	0	1
AT3G07870			F-box and associated interacti...		Lus10012357 [exp]	3.2	0.8402
AT1G43800			Plant stearoyl-acyl-carrier-pr...		Lus10028627 [exp]	10.5	0.8614
AT5G03310			SAUR-like auxin-responsive pro...		Lus10037990 [exp]	14.5	0.8186
AT4G34640		ERG9, SQS1	squalene synthase 1 (.1)		Lus10017499 [exp]	29.3	0.8447
AT4G17550		AtG3Pp4	glycerol-3-phosphate permease ...		Lus10040154 [exp]	30.4	0.8314
AT1G31770		ABCG14	ATP-binding cassette G14, ATP-...		Lus10037283 [exp]	32.7	0.8427
AT5G16260		ELF9	EARLY FLOWERING 9, RNA binding...		Lus10020230 [exp]	47.9	0.8133
AT1G29820			Magnesium transporter CorA-lik...		Lus10004605 [exp]	50.0	0.8214
AT5G45300	BZR	BAM8, BMY2	BETA-AMYLASE 8, beta-amylase 2...		Lus10035679 [exp]	52.4	0.7437
AT2G27240			Aluminium activated malate tra...		Lus10001846 [exp]	58.1	0.8086

Compare expression of checked genes

Lus10024049 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.