Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G80920 112 / 3e-32 AtToc12, AtJ8, J8 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) AT5G59610 51 / 4e-08 Chaperone DnaJ-domain superfamily protein (.1.2) AT1G79940 49 / 4e-07 ATERDJ2A DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4) AT1G72070 47 / 4e-07 Chaperone DnaJ-domain superfamily protein (.1) AT4G21180 48 / 9e-07 ATERDJ2B DnaJ / Sec63 Brl domains-containing protein (.1) AT3G62600 46 / 3e-06 ATERDJ3B DNAJ heat shock family protein (.1) AT3G08970 46 / 4e-06 TMS1, ATERDJ3A THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) AT5G16650 44 / 4e-06 Chaperone DnaJ-domain superfamily protein (.1) AT2G33735 42 / 2e-05 Chaperone DnaJ-domain superfamily protein (.1) AT2G41000 43 / 3e-05 Chaperone DnaJ-domain superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041671 [exp] 169 / 2e-54 AT1G80920 138 / 2e-42 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Lus10014352 [exp] 125 / 5e-37 AT1G80920 135 / 2e-41 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Lus10026061 [exp] 122 / 3e-36 AT1G80920 136 / 1e-41 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Lus10016510 [exp] 56 / 1e-09 AT5G59610 252 / 2e-83 Chaperone DnaJ-domain superfamily protein (.1.2) Lus10040777 [exp] 56 / 1e-09 AT5G59610 246 / 6e-81 Chaperone DnaJ-domain superfamily protein (.1.2) Lus10003380 [exp] 54 / 9e-09 AT3G08970 615 / 0.0 THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) Lus10002852 [exp] 53 / 2e-08 AT3G08970 600 / 0.0 THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) Lus10039293 [exp] 52 / 4e-08 AT1G79940 1086 / 0.0 DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4) Lus10027536 [exp] 52 / 4e-08 AT1G79940 1087 / 0.0 DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G183700 [exp] 129 / 2e-38 AT1G80920 130 / 4e-39 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Potri.001G043100 [exp] 127 / 1e-37 AT1G80920 129 / 2e-38 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Potri.001G072700 [exp] 55 / 3e-09 AT5G59610 254 / 3e-84 Chaperone DnaJ-domain superfamily protein (.1.2) Potri.016G120000 [exp] 52 / 2e-08 AT3G08970 479 / 6e-164 THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) Potri.014G122600 [exp] 51 / 7e-08 AT3G62600 565 / 0.0 DNAJ heat shock family protein (.1) Potri.004G072200 [exp] 48 / 9e-07 AT1G79940 1087 / 0.0 DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4) Potri.002G198000 [exp] 47 / 9e-07 AT3G62600 551 / 0.0 DNAJ heat shock family protein (.1) Potri.017G148800 [exp] 47 / 1e-06 AT1G79940 1062 / 0.0 DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4) Potri.019G041400 [exp] 45 / 1e-06 AT5G16650 193 / 5e-65 Chaperone DnaJ-domain superfamily protein (.1) Potri.001G255000 [exp] 46 / 3e-06 AT5G12430 738 / 0.0 tetratricopeptide repeat 16, Heat shock protein DnaJ with tetratricopeptide repeat (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [flax] [poplar] Chaperone-J PF00226 [flax] [poplar] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Lus10024067 pacid=23141527 polypeptide=Lus10024067 locus=Lus10024067.g ID=Lus10024067.BGIv1.0 annot-version=v1.0 ATGGCTACCGCGGCTACGATGATCGGGAGCAGCAGGTGCGGCGGGTCTTCATCGCCGTCCTGGTTTCAATCGCATGACAGCCAAGAGATGAAGGTGATAA AAAACTTCGCAGGTAGAAGAAGGAACTCGTCCTGCAGGTCGTTCTGCGTGTCTTCTTCTTTGGTGAAGGATCCATACAAAACCTTAAGGATCAAGCCTGG CGCCTCCGAATCTGAGGTCAAAAAAGCCTTCCGCAAACTCGCTCTCCAGCATCATCCAGATGTTTGCAGAGGGAGCAATTGCGGGCTTAATTTCAGCATG ATCAATGAAGCGTACAATTCAATTTGGCGGGTCGCGGTGAGTAAATTGCAGGTTGTGATGATGAAATTGAGGCAGGAAGCAGCGACGCCGGAACCGGAGC CGGAATATGAACTGTGGGAGGAGTGGATGGGATGGGAAGGAGCAGGGATCAGGGACTATTCTTCCCATATTAATCCTTACATTTGA
AA sequence Show only first row Show all	>Lus10024067 pacid=23141527 polypeptide=Lus10024067 locus=Lus10024067.g ID=Lus10024067.BGIv1.0 annot-version=v1.0 MATAATMIGSSRCGGSSSPSWFQSHDSQEMKVIKNFAGRRRNSSCRSFCVSSSLVKDPYKTLRIKPGASESEVKKAFRKLALQHHPDVCRGSNCGLNFSM INEAYNSIWRVAVSKLQVVMMKLRQEAATPEPEPEYELWEEWMGWEGAGIRDYSSHINPYI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G80920		AtToc12, AtJ8, ...	translocon at the outer envelo...		Lus10024067 [exp]	0	1
AT1G80920		AtToc12, AtJ8, ...	translocon at the outer envelo...		Lus10041671 [exp]	1.4	0.9387
AT1G30280			Chaperone DnaJ-domain superfam...		Lus10005923 [exp]	2.0	0.9350
AT1G72100			late embryogenesis abundant do...		Lus10000723 [exp]	4.2	0.9260
AT5G56550		ATOXS3	oxidative stress 3 (.1)		Lus10011137 [exp]	5.3	0.9085
AT5G02320	MYB	MYB3R-5, ATMYB3...	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10008010 [exp]	6.3	0.9105
AT5G02020		SIS	Salt Induced Serine rich, unkn...		Lus10021101 [exp]	6.5	0.9103
AT5G19120			Eukaryotic aspartyl protease f...		Lus10021939 [exp]	6.6	0.9180
AT4G36040		J11	DnaJ11, Chaperone DnaJ-domain ...		Lus10034484 [exp]	6.6	0.8946
AT1G49230			RING/U-box superfamily protein...		Lus10006788 [exp]	6.7	0.8744
AT5G14490	NAC	ANAC085	NAC domain containing protein ...		Lus10003668 [exp]	7.1	0.8971

Compare expression of checked genes

Lus10024067 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.