Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041635 [exp] 95 / 2e-24 AT2G38720 550 / 0.0 microtubule-associated protein 65-5 (.1) Lus10008705 [exp] 59 / 4e-12 AT2G38720 565 / 0.0 microtubule-associated protein 65-5 (.1) Lus10026114 [exp] 58 / 1e-11 AT2G38720 553 / 0.0 microtubule-associated protein 65-5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G192400 [exp] 69 / 1e-15 AT2G38720 555 / 0.0 microtubule-associated protein 65-5 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024086 pacid=23141500 polypeptide=Lus10024086 locus=Lus10024086.g ID=Lus10024086.BGIv1.0 annot-version=v1.0 ATGGCACACCGAGGAGCCACCCCGTTGGGCCGTCACGCACCTTCAACTGGGAAGGAACGTAGAGAGAGCAAGTTCCATAGCGTGACACCTATCAACTATG TTGCTCTTGCTAAGGACGATCCAGTGTCTCGTGGTGACTACCCCTCTTCACTCGGGCGTAATACTACTGTAAATGGTTCTCCTCTTTCCATTAGGATTGC TGCTTAA
AA sequence Show only first row Show all	>Lus10024086 pacid=23141500 polypeptide=Lus10024086 locus=Lus10024086.g ID=Lus10024086.BGIv1.0 annot-version=v1.0 MAHRGATPLGRHAPSTGKERRESKFHSVTPINYVALAKDDPVSRGDYPSSLGRNTTVNGSPLSIRIAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10024086 [exp]	0	1
AT1G59950			NAD(P)-linked oxidoreductase s...		Lus10039266 [exp]	3.5	0.8604
AT1G27340			Galactose oxidase/kelch repeat...		Lus10003117 [exp]	5.1	0.8311
AT5G61280			Remorin family protein (.1)		Lus10034714 [exp]	7.9	0.8098
AT1G13810			Restriction endonuclease, type...		Lus10033589 [exp]	10.6	0.7846
					Lus10000538 [exp]	10.6	0.8001
AT5G49810		MMT	methionine S-methyltransferase...		Lus10038132 [exp]	12.2	0.7710
AT1G27180			disease resistance protein (TI...		Lus10000423 [exp]	13.7	0.7731
AT1G03910			unknown protein		Lus10030000 [exp]	21.0	0.7560
AT3G52420		ATOEP7	outer envelope membrane protei...		Lus10003733 [exp]	22.7	0.7910
AT1G08070		EMB3102, OTP82	ORGANELLE TRANSCRIPT PROCESSIN...		Lus10030053 [exp]	30.7	0.7957

Compare expression of checked genes

Lus10024086 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.