Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G79660 97 / 4e-28 unknown protein AT1G16170 87 / 4e-24 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041631 [exp] 163 / 6e-54 AT1G79660 119 / 9e-37 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G038750 [exp] 100 / 5e-29 AT1G16170 78 / 2e-20 unknown protein Potri.001G038200 [exp] 100 / 7e-29 AT1G16170 59 / 1e-12 unknown protein Potri.003G186400 [exp] 97 / 4e-28 AT1G16170 92 / 5e-26 unknown protein Potri.001G040300 [exp] 96 / 2e-27 AT1G16170 94 / 7e-27 unknown protein Potri.001G039700 [exp] 80 / 3e-21 AT1G16170 76 / 9e-20 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024088 pacid=23141519 polypeptide=Lus10024088 locus=Lus10024088.g ID=Lus10024088.BGIv1.0 annot-version=v1.0 ATGGTTCTTGACGGCTTATCTTCTCCGCGTAGGGTATCATCATCGATCCGGAAAGGAACCCCCAAGGACGAGCTTGGGAGCTTGTCGACGGTCCTTAACA GACACAGGTTCTTACTGACAGCTTTGGTTCTCTTGGCCTTCCTATGCACCATCTACCTCTACTTCGCCATTACACTAGGGGCGGCGGCAGCTACATGTTC AGGAATGTCAGGGAAAGAAAAGGCGTTGTGCCATTTGGAGCATGCAAAGACCTCCATGACTTCTGGAAAACTCAAATTTTTCTAA
AA sequence Show only first row Show all	>Lus10024088 pacid=23141519 polypeptide=Lus10024088 locus=Lus10024088.g ID=Lus10024088.BGIv1.0 annot-version=v1.0 MVLDGLSSPRRVSSSIRKGTPKDELGSLSTVLNRHRFLLTALVLLAFLCTIYLYFAITLGAAAATCSGMSGKEKALCHLEHAKTSMTSGKLKFF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G79660			unknown protein		Lus10024088 [exp]	0	1
AT2G37480			unknown protein		Lus10024420 [exp]	1.4	0.9023
AT1G24450		NFD2	NUCLEAR FUSION DEFECTIVE 2, Ri...		Lus10002362 [exp]	2.4	0.8999
AT1G29040			unknown protein		Lus10013930 [exp]	8.2	0.8835
AT5G50850		MAB1	MACCI-BOU, Transketolase famil...		Lus10032550 [exp]	8.3	0.8477
AT5G13160		PBS1	avrPphB susceptible 1, Protein...		Lus10015756 [exp]	10.6	0.8556
AT4G21215			unknown protein		Lus10018373 [exp]	11.0	0.8502
AT1G79660			unknown protein		Lus10041631 [exp]	11.2	0.7995
AT4G02080		ASAR1, ATSARA1C...	secretion-associated RAS super...		Lus10031408 [exp]	13.2	0.8801
AT4G27040		VPS22	EAP30/Vps36 family protein (.1...		Lus10004047 [exp]	13.5	0.8796
AT5G26340		ATSTP13, MSS1, ...	SUGAR TRANSPORT PROTEIN 13, Ma...		Lus10001201 [exp]	21.6	0.8395

Compare expression of checked genes

Lus10024088 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.