Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G73110 52 / 3e-09 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041627 [exp] 68 / 9e-15 AT1G73110 639 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G037300 [exp] 58 / 3e-11 AT1G73110 663 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.010G200500 [exp] 38 / 0.0003 AT2G39730 797 / 0.0 rubisco activase (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024092 pacid=23141495 polypeptide=Lus10024092 locus=Lus10024092.g ID=Lus10024092.BGIv1.0 annot-version=v1.0 ATGGCGTCATTGACTCTCTCTTTACTGGGACTTTTCTGGGCAGAGACAGTGAGCTTGCAAAAGGTGACGAGGTCATTTGAGCATCTCCAGGGCGATTACT ACATTGCTCCGCTCTTCATGGAGGACATAATCAATATTGTTCACAGAATGTATGAGAAAGATGACATTCCAAAGGAAGAGGTTATCGAGATTGTGAACAC ATTTCCAAACCAAGCAATCGTTGGAGTCTCTGCTGGAAGCTGGTTATTCTCTAATGAGAGAACAACAACTGGTTTAGAGTTGTGCAAGTAA
AA sequence Show only first row Show all	>Lus10024092 pacid=23141495 polypeptide=Lus10024092 locus=Lus10024092.g ID=Lus10024092.BGIv1.0 annot-version=v1.0 MASLTLSLLGLFWAETVSLQKVTRSFEHLQGDYYIAPLFMEDIINIVHRMYEKDDIPKEEVIEIVNTFPNQAIVGVSAGSWLFSNERTTTGLELCK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G73110			P-loop containing nucleoside t...		Lus10024092 [exp]	0	1
					Lus10038154 [exp]	1.4	0.9763
					Lus10033284 [exp]	2.4	0.9572
AT5G46090			Protein of unknown function (D...		Lus10018635 [exp]	2.8	0.9755
AT4G29035			Plant self-incompatibility pro...		Lus10022825 [exp]	3.0	0.9679
					Lus10038743 [exp]	6.0	0.9629
AT5G64440		ATFAAH	fatty acid amide hydrolase (.1...		Lus10035974 [exp]	6.7	0.9627
					Lus10018996 [exp]	7.5	0.9348
AT3G19550			unknown protein		Lus10013900 [exp]	7.9	0.9340
AT2G16630			Pollen Ole e 1 allergen and ex...		Lus10042394 [exp]	8.1	0.9249
AT1G78980		SRF5	STRUBBELIG-receptor family 5 (...		Lus10034790 [exp]	9.9	0.9540

Compare expression of checked genes

Lus10024092 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.