Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G08230 79 / 8e-20 glycine-rich protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041619 [exp] 53 / 3e-10 AT4G08230 53 / 8e-11 glycine-rich protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G086600 [exp] 88 / 1e-23 AT4G08230 98 / 5e-28 glycine-rich protein (.1.2) Potri.005G174700 [exp] 87 / 3e-23 AT4G08230 97 / 1e-27 glycine-rich protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10961 [flax] [poplar] SelK_SelG Selenoprotein SelK_SelG
Representative CDS sequence Show only first row Show all	>Lus10024100 pacid=23141532 polypeptide=Lus10024100 locus=Lus10024100.g ID=Lus10024100.BGIv1.0 annot-version=v1.0 ATGGCCATATGGGGGCGCTTTACACCTTCACTTTGTAGGGCTTGGTACCATTCAATTAAACACTTGAGCGTCTTTTCCTTTTCAGGTGTTGTGAGATCTA AGAAATCCTTATGGCGTCTAAAGACTTACACGGACTTATTTTGGGAATTCATCAATCTCATTGCTATTTTCTTTACGACCATGTTCTCGATGGATAAGTC AGATGCTTACAGGAAAGGAAGTGGTTCTAGCAAGAAATGGGACGGTGGACCTGGAGGACCTGGAAGTGGACCGTATGGTGGAGGCCGTCCGGGTGGTCCA CGCAGAGGAGGACTCGACAATGTTCGACAACTTAATCACAACTCCTTACCTGCCTGTGGTTCCTGCTGCGGCTAA
AA sequence Show only first row Show all	>Lus10024100 pacid=23141532 polypeptide=Lus10024100 locus=Lus10024100.g ID=Lus10024100.BGIv1.0 annot-version=v1.0 MAIWGRFTPSLCRAWYHSIKHLSVFSFSGVVRSKKSLWRLKTYTDLFWEFINLIAIFFTTMFSMDKSDAYRKGSGSSKKWDGGPGGPGSGPYGGGRPGGP RRGGLDNVRQLNHNSLPACGSCCG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G08230			glycine-rich protein (.1.2)		Lus10024100 [exp]	0	1
AT5G42300		UBL5	ubiquitin-like protein 5 (.1)		Lus10023188 [exp]	1.0	0.9230
AT1G27000			Protein of unknown function (D...		Lus10037210 [exp]	2.0	0.8759
AT4G39235			unknown protein		Lus10004160 [exp]	2.4	0.8843
AT4G14880		OLD3, CYTACS1, ...	ONSET OF LEAF DEATH 3, O-acety...		Lus10019003 [exp]	3.6	0.8512
AT2G19830		VPS32, SNF7.2	SNF7 family protein (.1)		Lus10012921 [exp]	4.2	0.8942
AT2G06530		VPS2.1	SNF7 family protein (.1)		Lus10021561 [exp]	4.6	0.8626
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10033806 [exp]	4.9	0.8593
AT5G64260		EXL2, MSJ1.10	EXORDIUM like 2 (.1)		Lus10036484 [exp]	8.0	0.8467
AT1G66240		ATX1, ATATX1	homolog of anti-oxidant 1 (.1....		Lus10028859 [exp]	8.1	0.8739
AT1G70250			receptor serine/threonine kina...		Lus10025553 [exp]	8.2	0.8440

Compare expression of checked genes

Lus10024100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.