Lus10024109 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12390 199 / 4e-66 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
AT5G13850 184 / 2e-60 NACA3 nascent polypeptide-associated complex subunit alpha-like protein 3 (.1)
AT3G49470 181 / 9e-59 NACA2 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
AT4G10480 176 / 8e-57 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1), Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.2)
AT1G33040 170 / 9e-55 NACA5 nascent polypeptide-associated complex subunit alpha-like protein 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041610 251 / 9e-87 AT3G12390 229 / 7e-77 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10026133 229 / 6e-79 AT3G12390 204 / 2e-68 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10008687 215 / 6e-70 AT3G15660 197 / 7e-62 A. THALIANA GLUTAREDOXIN 4, glutaredoxin 4 (.1.2)
Lus10032927 178 / 1e-57 AT3G49470 260 / 2e-88 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Lus10015579 178 / 1e-57 AT3G49470 260 / 1e-88 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G034400 219 / 5e-74 AT3G12390 204 / 5e-67 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.003G190800 219 / 7e-74 AT3G12390 204 / 7e-67 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.006G032000 206 / 6e-69 AT3G12390 215 / 2e-71 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.015G003300 181 / 6e-59 AT3G49470 172 / 4e-54 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Potri.012G006700 172 / 3e-55 AT3G49470 171 / 1e-53 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01849 NAC NAC domain
CL0214 UBA PF00627 UBA UBA/TS-N domain
Representative CDS sequence
>Lus10024109 pacid=23141578 polypeptide=Lus10024109 locus=Lus10024109.g ID=Lus10024109.BGIv1.0 annot-version=v1.0
ATGTTGAAGCTGGGAATGAAACCCATGACTGGTGTCAGTCGGGTTACCGTCAAAAAGAGCAAGAACATATTGTTCGTGATCTCAAAGCCTGATGTCTTCA
AGAGCCCGACATCAGACACGTACATAGTCTTTGGAGAAGCTAAGATTGAGGACATAAGCTCACAACTACAGTCTCAAGCAGCTGAGCAGTTCAGGGCTCC
CGACCTGAGTCATTTGAATGCAAAACCTGAGACTTCTAGCATGGCTCAGGATGACGATGATGATGTAGATGAAACTGGAGTCGAGCCGAAGGATATCGAG
TTGGTGATGACACAGGCAGGAGTCACAAGGGCCAAAGCTGTGAGGTCTCTCAAGGCGGCAGATGGAGACATTGTTTCTGCCATCATGGAGCTCACGACCT
GA
AA sequence
>Lus10024109 pacid=23141578 polypeptide=Lus10024109 locus=Lus10024109.g ID=Lus10024109.BGIv1.0 annot-version=v1.0
MLKLGMKPMTGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDISSQLQSQAAEQFRAPDLSHLNAKPETSSMAQDDDDDVDETGVEPKDIE
LVMTQAGVTRAKAVRSLKAADGDIVSAIMELTT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G12390 Nascent polypeptide-associated... Lus10024109 0 1
AT3G55280 RPL23A2, RPL23A... RIBOSOMAL PROTEIN L23A2, ribos... Lus10005883 1.0 0.9571
AT1G54690 HTA3 ,G-H2AX ,G... histone H2A 3, GAMMA H2AX, gam... Lus10027154 2.0 0.9349
AT2G29570 ATPCNA2, PCNA2 A. THALIANA PROLIFERATING CELL... Lus10001197 4.9 0.9328
AT5G62290 nucleotide-sensitive chloride ... Lus10027193 7.7 0.9274
AT5G37530 NAD(P)-binding Rossmann-fold s... Lus10002651 9.2 0.9323
AT5G09510 Ribosomal protein S19 family p... Lus10033856 9.2 0.9381
AT5G15200 Ribosomal protein S4 (.1.2) Lus10008624 9.5 0.9401
AT5G52470 ATFIB1, ATFBR1,... SKP1/ASK1-INTERACTING PROTEIN,... Lus10027503 9.7 0.9337
AT5G56740 HAG02, HAC7, HA... histone acetyltransferase of t... Lus10012916 10.2 0.9258
AT5G02610 Ribosomal L29 family protein ... Lus10024437 19.8 0.8563

Lus10024109 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.