Lus10024114 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08680 115 / 9e-31 ATP synthase alpha/beta family protein (.1)
AT5G08690 115 / 1e-30 ATP synthase alpha/beta family protein (.1)
AT5G08670 114 / 1e-30 ATP synthase alpha/beta family protein (.1)
ATCG00480 56 / 7e-10 ATCG00480.1, ATPB ATP synthase subunit beta (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035264 150 / 8e-44 AT5G08680 925 / 0.0 ATP synthase alpha/beta family protein (.1)
Lus10034631 150 / 2e-43 AT5G08680 928 / 0.0 ATP synthase alpha/beta family protein (.1)
Lus10034632 149 / 2e-43 AT5G08680 875 / 0.0 ATP synthase alpha/beta family protein (.1)
Lus10035263 88 / 5e-21 AT5G08680 782 / 0.0 ATP synthase alpha/beta family protein (.1)
Lus10009173 55 / 2e-09 ATCG00480 890 / 0.0 ATP synthase subunit beta (.1)
Lus10032826 50 / 2e-08 ATCG00480 219 / 2e-70 ATP synthase subunit beta (.1)
Lus10025635 41 / 0.0001 AT4G08180 1142 / 0.0 OSBP(oxysterol binding protein)-related protein 1C (.1), OSBP(oxysterol binding protein)-related protein 1C (.2), OSBP(oxysterol binding protein)-related protein 1C (.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G126600 133 / 2e-37 AT5G08690 892 / 0.0 ATP synthase alpha/beta family protein (.1)
Potri.010G116600 133 / 2e-37 AT5G08690 871 / 0.0 ATP synthase alpha/beta family protein (.1)
Potri.013G162800 57 / 2e-10 ATCG00480 927 / 0.0 ATP synthase subunit beta (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0275 HAS-barrel PF02874 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barrel domain
Representative CDS sequence
>Lus10024114 pacid=23141521 polypeptide=Lus10024114 locus=Lus10024114.g ID=Lus10024114.BGIv1.0 annot-version=v1.0
ATGCCCGCGGCTCCTGCACAATCGGTTTCGGTCACCACCGGCGGAAAGGGAGGAGGCAAGATCGTCGATGAGTTCATCGGGAGAGGTGCAATCAGGCAAG
TCTATCAGGTGATTGGTGCCATCGTCGATGTCAGATTCGACGAGGGTTTGCCTCCGATCTTGACCGCTCTCGAGGTGCTGGATAACTCAATCTATCTTGT
GCTTGAAGTCGCCCAACATTTGGGAGAGAACATGGTCAGGACCATGGCTATGGGTGGTACTGAAGGTTTGGTCAGAGGCCAACGCGTCCTCAACACTGGT
TCTCCCATCACTGTAAGAGAGGATCTGGCGGTGATTGCCATCCGGGGATTTGCAGTAGCAGCAGTTAGGGAGTTGTTCGACACTATTGTTGCAATGAGAT
GA
AA sequence
>Lus10024114 pacid=23141521 polypeptide=Lus10024114 locus=Lus10024114.g ID=Lus10024114.BGIv1.0 annot-version=v1.0
MPAAPAQSVSVTTGGKGGGKIVDEFIGRGAIRQVYQVIGAIVDVRFDEGLPPILTALEVLDNSIYLVLEVAQHLGENMVRTMAMGGTEGLVRGQRVLNTG
SPITVREDLAVIAIRGFAVAAVRELFDTIVAMR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G08680 ATP synthase alpha/beta family... Lus10024114 0 1
AT2G21090 Pentatricopeptide repeat (PPR-... Lus10019213 6.2 0.7748
AT3G20050 ATTCP-1 T-complex protein 1 alpha subu... Lus10036713 6.3 0.7499
Lus10019215 10.0 0.7746
AT2G45880 BZR BAM7, BMY4 BETA-AMYLASE 4, beta-amylase 7... Lus10017819 12.8 0.7399
AT3G49990 unknown protein Lus10015447 16.8 0.7621
AT5G20320 DCL4, ATDCL4 dicer-like 4 (.1.2) Lus10040013 20.5 0.7234
AT3G57570 ARM repeat superfamily protein... Lus10026305 23.0 0.6644
AT2G33640 DHHC-type zinc finger family p... Lus10025157 27.8 0.6996
AT5G04050 RNA-directed DNA polymerase (r... Lus10036278 29.4 0.7201
AT5G66550 Maf-like protein (.1) Lus10040204 29.6 0.7213

Lus10024114 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.