Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03773 98 / 5e-27 HSP20-like chaperones superfamily protein (.1.2) AT4G02450 94 / 1e-24 HSP20-like chaperones superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000340 [exp] 193 / 5e-63 AT4G02450 120 / 5e-34 HSP20-like chaperones superfamily protein (.1.2) Lus10026136 [exp] 173 / 3e-55 AT4G02450 122 / 1e-34 HSP20-like chaperones superfamily protein (.1.2) Lus10008680 [exp] 176 / 7e-55 AT5G04940 216 / 8e-64 SU(VAR)3-9 homolog 1 (.1), SU(VAR)3-9 homolog 1 (.2) Lus10010669 [exp] 97 / 1e-26 AT3G03773 223 / 6e-76 HSP20-like chaperones superfamily protein (.1.2) Lus10002623 [exp] 92 / 7e-25 AT3G03773 165 / 2e-53 HSP20-like chaperones superfamily protein (.1.2) Lus10020270 [exp] 89 / 1e-21 AT5G55000 430 / 2e-149 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G061500 [exp] 137 / 3e-42 AT4G02450 123 / 4e-35 HSP20-like chaperones superfamily protein (.1.2) Potri.005G199700 [exp] 135 / 1e-41 AT4G02450 127 / 9e-37 HSP20-like chaperones superfamily protein (.1.2) Potri.013G062600 [exp] 98 / 4e-27 AT3G03773 191 / 3e-63 HSP20-like chaperones superfamily protein (.1.2) Potri.019G038550 [exp] 96 / 3e-26 AT3G03773 197 / 5e-66 HSP20-like chaperones superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0190 [flax] [poplar] HSP20 PF04969 [flax] [poplar] CS CS domain
Representative CDS sequence Show only first row Show all	>Lus10024119 pacid=23141464 polypeptide=Lus10024119 locus=Lus10024119.g ID=Lus10024119.BGIv1.0 annot-version=v1.0 ATGAGCCGGCACCCAATTTTGAAGTGGGCACAGAGAAGTGATAGAATCTTCATCACTGTGGAGTTACCAGATGCTAAAGATGTCAAACTCGAGCTTGAAC CTGAAGGAAGATTCACATTTTCAGCCACTAAGGATGGAGTTGCATATGATGTAGATCTCGAGCTGTTTGACAAAGTCGACATTGAGGAGAGCAAGTATAA CATTGGTGTGAGAAGCATTGTGTATGTCATAAACAAAGCTGAGAATAAGTGGTGGCCCAGGTTGATTAAGCAAGAAAGCAAGGCTCCTGCTTTCCTGAAA GTTGATTGGGATAAATGGGTTGACGAGGATGAAGAAAGTGGTACGTTCCATTGA
AA sequence Show only first row Show all	>Lus10024119 pacid=23141464 polypeptide=Lus10024119 locus=Lus10024119.g ID=Lus10024119.BGIv1.0 annot-version=v1.0 MSRHPILKWAQRSDRIFITVELPDAKDVKLELEPEGRFTFSATKDGVAYDVDLELFDKVDIEESKYNIGVRSIVYVINKAENKWWPRLIKQESKAPAFLK VDWDKWVDEDEESGTFH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G03773			HSP20-like chaperones superfam...		Lus10024119 [exp]	0	1
AT4G02450			HSP20-like chaperones superfam...		Lus10000340 [exp]	5.2	0.8635
AT3G60450			Phosphoglycerate mutase family...		Lus10024765 [exp]	5.6	0.7563
AT3G58810		ATMTPA2, MTP3, ...	ARABIDOPSIS METAL TOLERANCE PR...		Lus10002674 [exp]	10.6	0.8084
AT1G11840		ATGLX1	glyoxalase I homolog (.1.2.3.4...		Lus10002943 [exp]	11.2	0.8093
AT2G35900			unknown protein		Lus10021249 [exp]	11.6	0.8135
AT2G32120		HSP70T-2	heat-shock protein 70T-2 (.1.2...		Lus10041207 [exp]	12.3	0.8378
AT1G07400			HSP20-like chaperones superfam...		Lus10040722 [exp]	13.2	0.8197
AT1G76060		EMB1793	EMBRYO DEFECTIVE 1793, LYR fam...		Lus10017248 [exp]	15.3	0.7511
AT2G29500			HSP20-like chaperones superfam...		Lus10040723 [exp]	19.2	0.7531
AT3G08690		ATUBC11, UBC11	ubiquitin-conjugating enzyme 1...		Lus10009422 [exp]	21.5	0.8143

Compare expression of checked genes

Lus10024119 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.