Lus10024139 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G56710 59 / 2e-11 SIB1 sigma factor binding protein 1 (.1)
AT2G41180 54 / 2e-09 SIB2 sigma factor binding protein 2, VQ motif-containing protein (.1)
AT3G58000 42 / 3e-05 VQ motif-containing protein (.1)
AT2G42140 40 / 0.0001 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039494 252 / 6e-87 AT3G56710 56 / 3e-10 sigma factor binding protein 1 (.1)
Lus10039493 247 / 5e-85 AT3G56710 54 / 1e-09 sigma factor binding protein 1 (.1)
Lus10026165 73 / 5e-17 AT3G56710 44 / 3e-06 sigma factor binding protein 1 (.1)
Lus10008659 72 / 2e-16 ND 44 / 4e-06
Lus10038985 49 / 3e-07 AT3G56710 54 / 3e-09 sigma factor binding protein 1 (.1)
Lus10005523 48 / 4e-07 ND 46 / 2e-06
Lus10027279 47 / 1e-06 AT3G56710 46 / 2e-06 sigma factor binding protein 1 (.1)
Lus10006569 46 / 2e-06 ND 44 / 1e-05
Lus10022005 44 / 5e-06 AT3G56710 48 / 1e-07 sigma factor binding protein 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G194700 92 / 4e-24 AT3G56710 54 / 6e-10 sigma factor binding protein 1 (.1)
Potri.001G029700 89 / 4e-23 AT3G56710 54 / 5e-10 sigma factor binding protein 1 (.1)
Potri.006G038900 57 / 9e-11 AT2G41180 56 / 2e-10 sigma factor binding protein 2, VQ motif-containing protein (.1)
Potri.016G036600 56 / 5e-10 AT3G56710 48 / 2e-07 sigma factor binding protein 1 (.1)
Potri.013G043800 50 / 3e-08 AT2G41180 / sigma factor binding protein 2, VQ motif-containing protein (.1)
Potri.016G093900 50 / 5e-08 AT2G41180 / sigma factor binding protein 2, VQ motif-containing protein (.1)
Potri.019G013750 47 / 3e-07 AT3G56710 46 / 7e-07 sigma factor binding protein 1 (.1)
Potri.019G013300 47 / 3e-07 AT2G41180 47 / 3e-07 sigma factor binding protein 2, VQ motif-containing protein (.1)
Potri.016G046000 42 / 4e-05 AT3G58000 120 / 1e-34 VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Lus10024139 pacid=23141586 polypeptide=Lus10024139 locus=Lus10024139.g ID=Lus10024139.BGIv1.0 annot-version=v1.0
ATGGATTACGGACTTGGTGTTAACATGAAGAGCAGATCTGGTAGCTACAACAGGAAGGCAAGTACGAAGAGCAACAAGGACGTGAAAGTTGTGTACATCT
CAACTCCTATGAAGGTGAAGACCAGCGCAGCTGAATTCAGAGCTTTGGTCCAGGAGCTCACCGGCAAGGACTCCGATACCGCCCGGCTCATGGAGGTCAA
AGGGAACGAGGAGTTGATGATGATAAAGAAGAAGAAGAATAAGAAGAAGAGGAATGACACGGAAAGTACAGGAACAAGGGCAGATAATGAGTCATTGACG
TCGTCATATGATGGTGACCATCATCATTCGTCGTCGCCGTTCATTCACCAGCAGCAAGAGTACTCCTCCACGTGTTCCGATTACTCGGCGTCTACGACGT
CGTTGGATGAGCAGGAAGCGTTGATGTTGCCGATGGAGGGTAGCTTCATGAGCTTGTTTCAGCCCAATTTTTTGACTGAATTCAAACTCAACGAGATAGA
TGAGTTGAACTATTGA
AA sequence
>Lus10024139 pacid=23141586 polypeptide=Lus10024139 locus=Lus10024139.g ID=Lus10024139.BGIv1.0 annot-version=v1.0
MDYGLGVNMKSRSGSYNRKASTKSNKDVKVVYISTPMKVKTSAAEFRALVQELTGKDSDTARLMEVKGNEELMMIKKKKNKKKRNDTESTGTRADNESLT
SSYDGDHHHSSSPFIHQQQEYSSTCSDYSASTTSLDEQEALMLPMEGSFMSLFQPNFLTEFKLNEIDELNY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G56710 SIB1 sigma factor binding protein 1... Lus10024139 0 1
AT2G38470 WRKY ATWRKY33, WRKY3... WRKY DNA-binding protein 33 (.... Lus10001265 2.4 0.9277
AT3G56710 SIB1 sigma factor binding protein 1... Lus10039494 2.4 0.8800
AT5G07580 AP2_ERF Integrase-type DNA-binding sup... Lus10004752 3.0 0.8670
AT2G38470 WRKY ATWRKY33, WRKY3... WRKY DNA-binding protein 33 (.... Lus10012215 3.5 0.9154
AT5G59730 ATEXO70H7 exocyst subunit exo70 family p... Lus10005436 5.0 0.8837
AT5G41330 BTB/POZ domain with WD40/YVTN ... Lus10024643 5.2 0.9099
AT3G02600 ATLPP3, LPP3 lipid phosphate phosphatase 3 ... Lus10034630 7.2 0.8333
AT2G23460 ATXLG1, XLG1 extra-large G-protein 1 (.1) Lus10023838 8.9 0.8556
AT1G13570 F-box/RNI-like superfamily pro... Lus10028368 10.5 0.7519
AT1G80840 WRKY ATWRKY40, WRKY4... WRKY DNA-binding protein 40 (.... Lus10026082 11.7 0.8738

Lus10024139 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.