Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53170 97 / 3e-25 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G48730 71 / 5e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G35130 52 / 2e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT2G41720 51 / 6e-09 EMB2654 EMBRYO DEFECTIVE 2654, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G18900 49 / 2e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3) AT1G74750 48 / 7e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62720 48 / 9e-08 AtNG1 novel gene 1, Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT4G11690 46 / 3e-07 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G06430 45 / 5e-07 AtPPR2, EMB2750 pentatricopeptide repeat 2, embryo defective 2750, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63080 44 / 1e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024893 [exp] 155 / 7e-47 AT3G53170 543 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10022787 [exp] 69 / 4e-15 AT5G48730 687 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10011849 [exp] 69 / 4e-15 AT5G48730 681 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10035818 [exp] 56 / 2e-10 AT4G30825 1049 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10036600 [exp] 55 / 3e-10 AT4G30825 428 / 3e-144 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10042068 [exp] 52 / 4e-09 AT2G41720 1057 / 0.0 EMBRYO DEFECTIVE 2654, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10018075 [exp] 52 / 4e-09 AT2G41720 1020 / 0.0 EMBRYO DEFECTIVE 2654, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10025473 [exp] 51 / 7e-09 AT2G18940 970 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10006962 [exp] 49 / 3e-08 AT2G18940 976 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G058300 [exp] 112 / 1e-30 AT3G53170 618 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G243600 [exp] 79 / 9e-19 AT5G48730 691 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.010G153900 [exp] 56 / 2e-10 AT3G06430 717 / 0.0 pentatricopeptide repeat 2, embryo defective 2750, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G123600 [exp] 52 / 2e-09 AT2G35130 852 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.008G098700 [exp] 51 / 8e-09 AT3G06430 692 / 0.0 pentatricopeptide repeat 2, embryo defective 2750, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G030200 [exp] 50 / 9e-09 AT1G19720 985 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.006G166200 [exp] 48 / 7e-08 AT2G18940 1082 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.010G084000 [exp] 47 / 1e-07 AT3G22670 489 / 3e-168 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G141800 [exp] 47 / 2e-07 AT2G06000 588 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2) Potri.019G043101 [exp] 47 / 2e-07 AT5G14770 796 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10024144 pacid=23141598 polypeptide=Lus10024144 locus=Lus10024144.g ID=Lus10024144.BGIv1.0 annot-version=v1.0 ATGAGGCATGTGGAGAATTCGGATGTGGTTCTGGATACTCCTTTCTTTAACTGTGTCATCAGTGCTTATGGTCGTGCTGGAGAAGTGGAAAACATGGAAG GGTTGTTTTCGAGCATGGCAGAGAAGAATTGCAGGCCTGATTATGTCGCGTACGCTACTATGATCCAGGCTTACAATGCGAGAGGAATGACGGACCCTGC AATAGATTTGGAAAAGAAGATGCTTGCAGCACAAAAAAGATCAGGTATCTGA
AA sequence Show only first row Show all	>Lus10024144 pacid=23141598 polypeptide=Lus10024144 locus=Lus10024144.g ID=Lus10024144.BGIv1.0 annot-version=v1.0 MRHVENSDVVLDTPFFNCVISAYGRAGEVENMEGLFSSMAEKNCRPDYVAYATMIQAYNARGMTDPAIDLEKKMLAAQKRSGI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53170			Tetratricopeptide repeat (TPR)...		Lus10024144 [exp]	0	1
AT1G19880			Regulator of chromosome conden...		Lus10010614 [exp]	2.4	0.7532
AT1G01970			Tetratricopeptide repeat (TPR)...		Lus10015865 [exp]	4.6	0.6832
AT1G65450			HXXXD-type acyl-transferase fa...		Lus10029920 [exp]	6.8	0.7683
AT5G11730			Core-2/I-branching beta-1,6-N-...		Lus10034348 [exp]	9.6	0.7683
AT2G32030			Acyl-CoA N-acyltransferases (N...		Lus10032323 [exp]	9.7	0.7543
AT1G52190			Major facilitator superfamily ...		Lus10008539 [exp]	11.1	0.7618
					Lus10034069 [exp]	12.2	0.7600
AT5G37060		ATCHX24	cation/H+ exchanger 24, ARABID...		Lus10031852 [exp]	18.1	0.7491
					Lus10011276 [exp]	18.2	0.7461
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10007909 [exp]	19.0	0.7479

Compare expression of checked genes

Lus10024144 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.