Lus10024160 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10024160 pacid=23141552 polypeptide=Lus10024160 locus=Lus10024160.g ID=Lus10024160.BGIv1.0 annot-version=v1.0
ATGGCGAGAGATAGTTGCTTGACGCGTGTCGTTGCCGGCGTTGCCATCGGCGGTGGTGTTGGTGGCGCTGTAGGGAAAGAAGTTAGTTTCTGTTTACTGA
GCTTGGCTGTGTCAATAACGATGGACATATGGAATATCTATGCTGTTTGCTTCTTGTTCCAAGTTAATGGAATTCAGTCTAGAGCCAGAAGTGCTGTATA
TGGAACTTATGAGGCCATTAGGCATAAGCTGAAATACAATCTGGGAGAAGATCAGCAGCCAGGAACTCTTCCATGGTGGAAACCCATAGACGATATGCAG
GAATACCATTTATGA
AA sequence
>Lus10024160 pacid=23141552 polypeptide=Lus10024160 locus=Lus10024160.g ID=Lus10024160.BGIv1.0 annot-version=v1.0
MARDSCLTRVVAGVAIGGGVGGAVGKEVSFCLLSLAVSITMDIWNIYAVCFLFQVNGIQSRARSAVYGTYEAIRHKLKYNLGEDQQPGTLPWWKPIDDMQ
EYHL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10024160 0 1
AT1G50420 GRAS SCL-3, SCL3 scarecrow-like 3 (.1) Lus10037756 1.7 0.7682
AT3G26040 HXXXD-type acyl-transferase fa... Lus10036126 2.6 0.8104
AT2G13620 ATCHX15 CATION/H+ EXCHANGER 15, cation... Lus10013794 6.9 0.7212
Lus10008440 8.1 0.7922
Lus10013672 13.0 0.7477
AT3G26040 HXXXD-type acyl-transferase fa... Lus10026237 13.8 0.7246
AT5G19530 ACL5 ACAULIS 5, S-adenosyl-L-methio... Lus10033437 13.9 0.6649
AT3G19270 CYP707A4 "cytochrome P450, family 707, ... Lus10019858 14.1 0.6044
AT1G80730 C2H2ZnF ATZFP1, ZFP1 ARABIDOPSIS THALIANA ZINC-FING... Lus10008698 14.7 0.6618
AT2G03220 ATFUT1, ATFT1, ... MURUS 2, ARABIDOPSIS THALIANA ... Lus10026128 15.2 0.7039

Lus10024160 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.