Lus10024161 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G70600 263 / 6e-92 Ribosomal protein L18e/L15 superfamily protein (.1)
AT1G23290 257 / 1e-89 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
AT1G12960 131 / 2e-40 Ribosomal protein L18e/L15 superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039528 295 / 2e-104 AT1G70600 264 / 2e-92 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10036855 277 / 1e-97 AT1G70600 255 / 8e-89 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10006207 276 / 4e-97 AT1G70600 254 / 1e-88 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10004617 275 / 7e-97 AT1G23290 258 / 5e-90 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10016336 275 / 1e-96 AT1G23290 253 / 3e-88 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10026698 273 / 5e-96 AT1G23290 256 / 2e-89 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G202300 277 / 9e-98 AT1G70600 238 / 5e-82 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.008G187000 275 / 8e-97 AT1G70600 238 / 3e-82 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.016G069000 275 / 1e-96 AT1G70600 268 / 7e-94 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.010G045800 274 / 2e-96 AT1G70600 237 / 1e-81 Ribosomal protein L18e/L15 superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0588 Ribos_L15p_L18e PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Representative CDS sequence
>Lus10024161 pacid=23141528 polypeptide=Lus10024161 locus=Lus10024161.g ID=Lus10024161.BGIv1.0 annot-version=v1.0
ATGACGACCCGCTTCAAGAAGAATCGCAAGAAGAGAGGCCATGTCAGCGCCGGACACGGTCGTATCGGAAAGCACAGGAAGCATCCTGGAGGTCGCGGTA
ACGCCGGAGGTATGCACCACCACAGGATCCTCTTCGACAAGTACCACCCAGGTTACTTCGGGAAAGTTGGTATGAGGTACTTCCACAAGCTCAAAAACAG
GTTCTTCTGCCCGATCGTCAACATCGACAAGCTCTGGTCATTGGTCCCTCGGGAGGTGAAGGATAAGGCAGGGAAGGATGCAGCTCCGATGATTGACGTC
ACTCAGTTCGGTTACTTCAAGGTGCTTGGTAAGGGTGTTTTGCCTGATAACCAACCCATCGTGGTCAAGGCTAAGCTGGTGTCCAAGCAAGCTGAGAAGA
AAATCAAGGAAGCAGGGGGTGCTGTGGTTCTCACTGCCTAG
AA sequence
>Lus10024161 pacid=23141528 polypeptide=Lus10024161 locus=Lus10024161.g ID=Lus10024161.BGIv1.0 annot-version=v1.0
MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLKNRFFCPIVNIDKLWSLVPREVKDKAGKDAAPMIDV
TQFGYFKVLGKGVLPDNQPIVVKAKLVSKQAEKKIKEAGGAVVLTA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10024161 0 1
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10039528 2.8 0.8637
AT3G55605 Mitochondrial glycoprotein fam... Lus10030157 3.2 0.8681
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10036855 3.2 0.8844
AT5G60670 Ribosomal protein L11 family p... Lus10026506 4.6 0.8677
AT1G43170 RPL3A, ARP1, EM... embryo defective 2207, ribosom... Lus10006181 7.1 0.8545
AT5G60670 Ribosomal protein L11 family p... Lus10019935 7.4 0.8660
AT3G13160 Tetratricopeptide repeat (TPR)... Lus10018394 9.5 0.8647
AT3G13160 Tetratricopeptide repeat (TPR)... Lus10018393 11.5 0.8536
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10006207 12.0 0.8660
AT1G04480 Ribosomal protein L14p/L23e fa... Lus10024943 13.0 0.8309

Lus10024161 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.