Lus10024188 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G30360 79 / 5e-19 PKS5, CIPK11, SnRK3.22, SIP4 SNF1-RELATED PROTEIN KINASE 3.22, PROTEIN KINASE SOS2-LIKE 5, CBL-INTERACTING PROTEIN KINASE 11, SOS3-interacting protein 4 (.1)
AT5G01820 69 / 3e-15 PKS24, CIPK14, ATSR1, SnRK3.15, ATCIPK14 SNF1-RELATED PROTEIN KINASE 3.15, SOS2-like protein kinase 24, CBL-INTERACTING PROTEIN KINASE 14, serine/threonine protein kinase 1 (.1)
AT2G38490 68 / 5e-15 CIPK22, SnRK3.19 SNF1-RELATED PROTEIN KINASE 3.19, CBL-interacting protein kinase 22 (.1)
AT5G45810 67 / 1e-14 CIPK19, SnRK3.5 SNF1-RELATED PROTEIN KINASE 3.5, CBL-interacting protein kinase 19 (.1)
AT5G10930 67 / 2e-14 CIPK5, SnRK3.24 SNF1-RELATED PROTEIN KINASE 3.24, CBL-interacting protein kinase 5 (.1)
AT5G25110 67 / 2e-14 CIPK25, SnRK3.25 SNF1-RELATED PROTEIN KINASE 3.25, CBL-interacting protein kinase 25 (.1)
AT5G45820 67 / 2e-14 PKS18, CIPK20, SnRK3.6 SNF1-RELATED PROTEIN KINASE 3.6, PROTEIN KINASE 18, CBL-interacting protein kinase 20 (.1)
AT5G01810 65 / 6e-14 ATPK10, SnRK3.1, SIP2, PKS3, CIPK15 SNF1-RELATED PROTEIN KINASE 3.1, SOS3-INTERACTING PROTEIN 2, PROTEIN KINASE 10, CBL-interacting protein kinase 15 (.1.2.3)
AT4G18700 64 / 2e-13 ATWL4, CIPK12, SnRK3.9 SNF1-RELATED PROTEIN KINASE 3.9, WPL4-LIKE 4, CBL-interacting protein kinase 12 (.1)
AT1G29230 63 / 3e-13 ATCIPK18, ATWL1, CIPK18, SnRK3.20 SNF1-RELATED PROTEIN KINASE 3.20, WPL4-LIKE 1, CBL-interacting protein kinase 18 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009925 102 / 4e-27 AT2G30360 553 / 0.0 SNF1-RELATED PROTEIN KINASE 3.22, PROTEIN KINASE SOS2-LIKE 5, CBL-INTERACTING PROTEIN KINASE 11, SOS3-interacting protein 4 (.1)
Lus10025245 75 / 3e-17 AT5G01820 504 / 1e-177 SNF1-RELATED PROTEIN KINASE 3.15, SOS2-like protein kinase 24, CBL-INTERACTING PROTEIN KINASE 14, serine/threonine protein kinase 1 (.1)
Lus10009103 74 / 5e-17 AT2G30360 501 / 1e-176 SNF1-RELATED PROTEIN KINASE 3.22, PROTEIN KINASE SOS2-LIKE 5, CBL-INTERACTING PROTEIN KINASE 11, SOS3-interacting protein 4 (.1)
Lus10022748 71 / 5e-16 AT2G30360 491 / 3e-173 SNF1-RELATED PROTEIN KINASE 3.22, PROTEIN KINASE SOS2-LIKE 5, CBL-INTERACTING PROTEIN KINASE 11, SOS3-interacting protein 4 (.1)
Lus10022749 71 / 1e-15 AT5G58380 598 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1)
Lus10014163 71 / 1e-15 AT5G58380 592 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1)
Lus10019411 65 / 1e-13 AT5G35410 729 / 0.0 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1)
Lus10025396 60 / 6e-13 AT2G34180 198 / 1e-62 SNF1-RELATED PROTEIN KINASE 3.7, WPL4-LIKE 2, CBL-interacting protein kinase 13 (.1)
Lus10043264 62 / 7e-13 AT5G35410 630 / 0.0 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G155600 82 / 9e-20 AT2G30360 536 / 0.0 SNF1-RELATED PROTEIN KINASE 3.22, PROTEIN KINASE SOS2-LIKE 5, CBL-INTERACTING PROTEIN KINASE 11, SOS3-interacting protein 4 (.1)
Potri.019G128100 73 / 1e-16 AT2G30360 531 / 0.0 SNF1-RELATED PROTEIN KINASE 3.22, PROTEIN KINASE SOS2-LIKE 5, CBL-INTERACTING PROTEIN KINASE 11, SOS3-interacting protein 4 (.1)
Potri.016G133900 72 / 1e-16 AT5G01820 490 / 2e-172 SNF1-RELATED PROTEIN KINASE 3.15, SOS2-like protein kinase 24, CBL-INTERACTING PROTEIN KINASE 14, serine/threonine protein kinase 1 (.1)
Potri.016G133500 67 / 2e-14 AT5G58380 593 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1)
Potri.011G067600 66 / 3e-14 AT4G18700 720 / 0.0 SNF1-RELATED PROTEIN KINASE 3.9, WPL4-LIKE 4, CBL-interacting protein kinase 12 (.1)
Potri.018G130500 66 / 3e-14 AT5G35410 711 / 0.0 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1)
Potri.019G127500 65 / 6e-14 AT5G58380 641 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1)
Potri.006G068400 64 / 1e-13 AT5G35410 686 / 0.0 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1)
Potri.011G067500 64 / 2e-13 AT5G45820 647 / 0.0 SNF1-RELATED PROTEIN KINASE 3.6, PROTEIN KINASE 18, CBL-interacting protein kinase 20 (.1)
Potri.006G263500 64 / 2e-13 AT5G25110 568 / 0.0 SNF1-RELATED PROTEIN KINASE 3.25, CBL-interacting protein kinase 25 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Lus10024188 pacid=23175750 polypeptide=Lus10024188 locus=Lus10024188.g ID=Lus10024188.BGIv1.0 annot-version=v1.0
ATGAACTCGGAAAGCTCCTCGGTTGCGGCGCTTTCACCAAGATCTACCACGCTCGGAACATCTCCACCGGTCAGAGCGTCGCGGTCGAAAATCACCACCC
CTTCCATGATGTCCAACATCAAGCGTGAAATCTTCATCATGCGCCGTCTCAGCCACCCTCACATTGTCAAGCTCCACGAGGTCCTCGCCACCAGGACCAA
GATCTACTTCATCATGGAGTTTGTCAAAGGATTGGGAGCTCTTCGCCAAGATCTTTAA
AA sequence
>Lus10024188 pacid=23175750 polypeptide=Lus10024188 locus=Lus10024188.g ID=Lus10024188.BGIv1.0 annot-version=v1.0
MNSESSSVAALSPRSTTLGTSPPVRASRSKITTPSMMSNIKREIFIMRRLSHPHIVKLHEVLATRTKIYFIMEFVKGLGALRQDL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G30360 PKS5, CIPK11, S... SNF1-RELATED PROTEIN KINASE 3.... Lus10024188 0 1
AT5G20680 TBL16 TRICHOME BIREFRINGENCE-LIKE 16... Lus10039914 2.6 0.8699
AT5G60750 CAAX amino terminal protease f... Lus10017536 3.2 0.8453
AT5G37020 ARF ARF8, ATARF8 auxin response factor 8 (.1.2) Lus10017640 4.5 0.8225
AT5G51150 Mitochondrial import inner mem... Lus10032508 5.2 0.8303
AT2G01060 GARP myb-like HTH transcriptional r... Lus10038734 8.8 0.8108
AT1G71900 Protein of unknown function (D... Lus10019952 8.8 0.8190
AT1G23380 HD KNAT6S, KNAT6L,... KNOTTED1-like homeobox gene 6 ... Lus10013037 12.4 0.8194
AT1G80910 Protein of unknown function (D... Lus10021811 15.3 0.7614
AT1G19220 ARF IAA22, ARF11, A... indole-3-acetic acid inducible... Lus10033597 16.2 0.7941
AT4G24560 UBP16 ubiquitin-specific protease 16... Lus10015893 16.3 0.7822

Lus10024188 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.