Lus10024189 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10024189 pacid=23175806 polypeptide=Lus10024189 locus=Lus10024189.g ID=Lus10024189.BGIv1.0 annot-version=v1.0
ATGTTAGCCGCGGCACTGAGCCCTGACTTTGTCGCGTTCTCAATTCTCATGACTTGTCTCGGCGTACTTGGAGAAGGGGATGGTGGTGGAGGAGGAGGGA
GGTTCTACGACAACGACGTTGTTAGGGAGGAGGCTGCTGCTGGGTGGGCCGGGGTCGTCGCCGCCGAGGTGCACGTGGAAATGCGGAAAGTGCAAGCCGT
GCAAGCCGGTGCACGTGCCGGTGCCGCCAGGGACGCCGGTGACGGCAGAGTATTACCCGGAAGCATGGAGGTGCAAGTGTGGGAACAAGCTCTACATGCC
GTGATTAATATTGATGTGTAA
AA sequence
>Lus10024189 pacid=23175806 polypeptide=Lus10024189 locus=Lus10024189.g ID=Lus10024189.BGIv1.0 annot-version=v1.0
MLAAALSPDFVAFSILMTCLGVLGEGDGGGGGGRFYDNDVVREEAAAGWAGVVAAEVHVEMRKVQAVQAGARAGAARDAGDGRVLPGSMEVQVWEQALHA
VINIDV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10024189 0 1
AT1G19250 FMO1 flavin-dependent monooxygenase... Lus10013230 1.4 0.9345
AT4G35190 LOG5 LONELY GUY 5, Putative lysine ... Lus10003335 1.4 0.9521
AT5G59950 RNA-binding (RRM/RBD/RNP motif... Lus10023417 5.8 0.9003
Lus10011220 12.5 0.9138
AT3G45400 exostosin family protein (.1) Lus10005684 12.6 0.8591
AT3G52270 Transcription initiation facto... Lus10023502 12.8 0.8584
AT3G63300 FKD1 FORKED 1 (.1.2) Lus10004079 13.0 0.9168
AT2G45850 AT-hook AT hook motif DNA-binding fami... Lus10037858 13.2 0.8884
AT5G48170 SNE, SLY2 SNEEZY, SLEEPY2, F-box family ... Lus10001172 14.4 0.9096
AT4G31350 Core-2/I-branching beta-1,6-N-... Lus10020159 14.8 0.9060

Lus10024189 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.