Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60900 113 / 8e-31 RLK1 receptor-like protein kinase 1 (.1) AT5G24080 83 / 4e-20 Protein kinase superfamily protein (.1) AT1G34300 79 / 1e-18 lectin protein kinase family protein (.1) AT4G32300 77 / 3e-18 SD2-5 S-domain-2 5 (.1) AT4G00340 77 / 4e-18 RLK4 receptor-like protein kinase 4 (.1) AT5G35370 76 / 1e-17 S-locus lectin protein kinase family protein (.1) AT2G19130 76 / 2e-17 S-locus lectin protein kinase family protein (.1) AT5G54380 72 / 4e-16 THE1 THESEUS1, protein kinase family protein (.1) AT1G24650 71 / 6e-16 Leucine-rich repeat protein kinase family protein (.1) AT5G20050 71 / 1e-15 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030400 [exp] 152 / 1e-45 AT5G60900 356 / 1e-115 receptor-like protein kinase 1 (.1) Lus10018251 [exp] 134 / 1e-41 AT5G60900 213 / 2e-65 receptor-like protein kinase 1 (.1) Lus10031805 [exp] 129 / 4e-36 AT5G60900 530 / 5e-178 receptor-like protein kinase 1 (.1) Lus10031231 [exp] 129 / 4e-36 AT5G60900 536 / 2e-180 receptor-like protein kinase 1 (.1) Lus10024195 [exp] 127 / 2e-35 AT5G60900 367 / 3e-114 receptor-like protein kinase 1 (.1) Lus10031804 [exp] 112 / 2e-31 AT5G60900 234 / 2e-71 receptor-like protein kinase 1 (.1) Lus10031230 [exp] 111 / 6e-30 AT5G60900 388 / 4e-123 receptor-like protein kinase 1 (.1) Lus10042940 [exp] 107 / 1e-28 AT5G60900 381 / 1e-120 receptor-like protein kinase 1 (.1) Lus10004365 [exp] 107 / 2e-28 AT5G60900 545 / 0.0 receptor-like protein kinase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G211532 [exp] 120 / 2e-36 AT5G60900 164 / 1e-47 receptor-like protein kinase 1 (.1) Potri.003G211866 [exp] 124 / 1e-35 AT5G60900 346 / 4e-113 receptor-like protein kinase 1 (.1) Potri.001G228200 [exp] 127 / 2e-35 AT5G60900 601 / 0.0 receptor-like protein kinase 1 (.1) Potri.T084800 [exp] 125 / 4e-35 AT5G60900 485 / 3e-161 receptor-like protein kinase 1 (.1) Potri.003G211700 [exp] 125 / 5e-35 AT5G60900 527 / 5e-177 receptor-like protein kinase 1 (.1) Potri.T085100 [exp] 123 / 2e-34 AT5G60900 554 / 0.0 receptor-like protein kinase 1 (.1) Potri.T084900 [exp] 121 / 1e-33 AT5G60900 548 / 0.0 receptor-like protein kinase 1 (.1) Potri.001G014700 [exp] 120 / 2e-33 AT5G60900 575 / 0.0 receptor-like protein kinase 1 (.1) Potri.T085000 [exp] 119 / 1e-32 AT5G60900 559 / 0.0 receptor-like protein kinase 1 (.1) Potri.T084351 [exp] 115 / 3e-32 AT5G60900 419 / 4e-141 receptor-like protein kinase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10024196 pacid=23175789 polypeptide=Lus10024196 locus=Lus10024196.g ID=Lus10024196.BGIv1.0 annot-version=v1.0 ATGACAGCCAAGATATCCGATTTCGGGCTGGCAAAGCTTCTGATGGAAAACCAAACCAAGACAGTGACCGGAATCCGGGGCACGAAAGGTTATGTGGCTC CGGAGTGGTTCAGGAACATGCCTGTTACGGCCAAGGTTGATGTTCACAGCTTTGGGATTCTGCTTTTGGAGCTGGTTTGTTGCAGGAAAAAGATGGAACT GGAGGTAGCAAATGAAGAAGAAGTGATGCTTGCAGAGGGGCATATGAATGTTACAGTCAAGGTCACTTGA
AA sequence Show only first row Show all	>Lus10024196 pacid=23175789 polypeptide=Lus10024196 locus=Lus10024196.g ID=Lus10024196.BGIv1.0 annot-version=v1.0 MTAKISDFGLAKLLMENQTKTVTGIRGTKGYVAPEWFRNMPVTAKVDVHSFGILLLELVCCRKKMELEVANEEEVMLAEGHMNVTVKVT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G60900		RLK1	receptor-like protein kinase 1...		Lus10024196 [exp]	0	1
AT2G04220			Plant protein of unknown funct...		Lus10027127 [exp]	7.7	0.8614
AT1G11040			HSP40/DnaJ peptide-binding pro...		Lus10029685 [exp]	13.0	0.8628
AT3G50440		ATMES10	ARABIDOPSIS THALIANA METHYL ES...		Lus10022467 [exp]	31.4	0.8086
					Lus10000578 [exp]	35.2	0.7968
AT1G69500		CYP704B1	"cytochrome P450, family 704, ...		Lus10037157 [exp]	48.1	0.7970
					Lus10021189 [exp]	53.7	0.8150
AT1G56580		SVB	SMALLER WITH VARIABLE BRANCHES...		Lus10000354 [exp]	59.2	0.7914
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10042994 [exp]	61.3	0.7862
AT2G23770			protein kinase family protein ...		Lus10021889 [exp]	69.3	0.7959
AT3G27670		RST1	RESURRECTION1, ARM repeat supe...		Lus10010374 [exp]	80.5	0.7919

Compare expression of checked genes

Lus10024196 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.