Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60900 59 / 2e-12 RLK1 receptor-like protein kinase 1 (.1) AT1G34300 50 / 3e-09 lectin protein kinase family protein (.1) AT2G19130 49 / 8e-09 S-locus lectin protein kinase family protein (.1) AT4G18250 47 / 4e-08 receptor serine/threonine kinase, putative (.1) AT4G32300 47 / 4e-08 SD2-5 S-domain-2 5 (.1) AT5G24080 47 / 4e-08 Protein kinase superfamily protein (.1) AT4G00340 47 / 4e-08 RLK4 receptor-like protein kinase 4 (.1) AT2G41890 46 / 9e-08 curculin-like (mannose-binding) lectin family protein / PAN domain-containing protein (.1) AT1G70250 45 / 3e-07 receptor serine/threonine kinase, putative (.1) AT5G38250 44 / 6e-07 Protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018251 [exp] 90 / 1e-24 AT5G60900 213 / 2e-65 receptor-like protein kinase 1 (.1) Lus10009916 [exp] 86 / 5e-24 AT5G60900 94 / 6e-24 receptor-like protein kinase 1 (.1) Lus10030400 [exp] 86 / 1e-21 AT5G60900 356 / 1e-115 receptor-like protein kinase 1 (.1) Lus10031805 [exp] 76 / 4e-18 AT5G60900 530 / 5e-178 receptor-like protein kinase 1 (.1) Lus10031231 [exp] 76 / 6e-18 AT5G60900 536 / 2e-180 receptor-like protein kinase 1 (.1) Lus10024195 [exp] 75 / 8e-18 AT5G60900 367 / 3e-114 receptor-like protein kinase 1 (.1) Lus10031230 [exp] 61 / 1e-12 AT5G60900 388 / 4e-123 receptor-like protein kinase 1 (.1) Lus10004365 [exp] 58 / 8e-12 AT5G60900 545 / 0.0 receptor-like protein kinase 1 (.1) Lus10006052 [exp] 55 / 1e-10 AT1G34300 961 / 0.0 lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T085100 [exp] 79 / 2e-19 AT5G60900 554 / 0.0 receptor-like protein kinase 1 (.1) Potri.T085000 [exp] 76 / 2e-18 AT5G60900 559 / 0.0 receptor-like protein kinase 1 (.1) Potri.T085150 [exp] 76 / 3e-18 AT5G60900 554 / 0.0 receptor-like protein kinase 1 (.1) Potri.003G211532 [exp] 72 / 3e-18 AT5G60900 164 / 1e-47 receptor-like protein kinase 1 (.1) Potri.003G211366 [exp] 76 / 5e-18 AT5G60900 568 / 0.0 receptor-like protein kinase 1 (.1) Potri.003G211700 [exp] 76 / 5e-18 AT5G60900 527 / 5e-177 receptor-like protein kinase 1 (.1) Potri.003G211866 [exp] 74 / 1e-17 AT5G60900 346 / 4e-113 receptor-like protein kinase 1 (.1) Potri.T084900 [exp] 74 / 2e-17 AT5G60900 548 / 0.0 receptor-like protein kinase 1 (.1) Potri.T084601 [exp] 74 / 2e-17 AT5G60900 519 / 3e-174 receptor-like protein kinase 1 (.1) Potri.003G211800 [exp] 73 / 2e-17 AT5G60900 550 / 0.0 receptor-like protein kinase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024197 pacid=23175791 polypeptide=Lus10024197 locus=Lus10024197.g ID=Lus10024197.BGIv1.0 annot-version=v1.0 ATGGCTGACATGGGAAAAGTCGAGAGATTCGTCAAGGTTGCGATATGGTGTATTCAGGACGATCCATCGATGAGGCCTGCAATGAAGAAAGTTGTTCATA TGTTGGAAGGATCTGTCCATGTCCCTCCTCCTCCAGATCCTGATTCCTTCATCAGCAGCATATGA
AA sequence Show only first row Show all	>Lus10024197 pacid=23175791 polypeptide=Lus10024197 locus=Lus10024197.g ID=Lus10024197.BGIv1.0 annot-version=v1.0 MADMGKVERFVKVAIWCIQDDPSMRPAMKKVVHMLEGSVHVPPPPDPDSFISSI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G60900		RLK1	receptor-like protein kinase 1...		Lus10024197 [exp]	0	1
AT5G59460			scarecrow-like transcription f...		Lus10001576 [exp]	10.5	0.7946
					Lus10011647 [exp]	22.3	0.6813
AT1G71440		TFCE, PFI	TUBULIN-FOLDING COFACTOR E, tu...		Lus10002948 [exp]	102.3	0.7009
AT1G12400			Nucleotide excision repair, TF...		Lus10000383 [exp]	116.3	0.6836
AT5G52200		AtI-2	inhibitor-2, phosphoprotein ph...		Lus10005751 [exp]	119.2	0.7053
AT4G12480		PEARLI 1 1, PEA...	EARLY ARABIDOPSIS ALUMINUM IND...		Lus10036494 [exp]	153.9	0.6660
AT3G07180			GPI transamidase component PIG...		Lus10022779 [exp]	162.2	0.6963
					Lus10000299 [exp]	169.4	0.6642
AT3G12130	C3HZnF		KH domain-containing protein /...		Lus10016272 [exp]	198.6	0.6840
AT2G39550		GGB, ATGGT-IB, ...	GERANYLGERANYLTRANSFERASE-I BE...		Lus10019318 [exp]	248.3	0.6726

Compare expression of checked genes

Lus10024197 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.