Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59320 57 / 5e-12 LTP3 lipid transfer protein 3 (.1) AT3G51590 52 / 5e-10 LTP12 lipid transfer protein 12 (.1) AT2G38540 50 / 1e-09 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT3G51600 49 / 4e-09 LTP5 lipid transfer protein 5 (.1) AT5G59310 47 / 2e-08 LTP4 lipid transfer protein 4 (.1) AT2G38530 46 / 5e-08 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT3G08770 45 / 1e-07 LTP6 lipid transfer protein 6 (.1.2) AT5G01870 45 / 2e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G15050 45 / 2e-07 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT4G33355 43 / 1e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009911 [exp] 142 / 1e-45 AT5G59320 72 / 4e-17 lipid transfer protein 3 (.1) Lus10042210 [exp] 83 / 2e-22 AT5G59320 86 / 6e-23 lipid transfer protein 3 (.1) Lus10008606 [exp] 84 / 1e-20 AT5G59320 84 / 3e-19 lipid transfer protein 3 (.1) Lus10022745 [exp] 67 / 8e-16 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10014167 [exp] 66 / 2e-15 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10015279 [exp] 59 / 1e-12 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10026418 [exp] 58 / 1e-12 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10025234 [exp] 56 / 1e-11 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1) Lus10025402 [exp] 53 / 2e-10 ND 66 / 1e-14
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086500 [exp] 64 / 1e-14 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086600 [exp] 62 / 4e-14 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.001G232900 [exp] 54 / 5e-11 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135500 [exp] 54 / 5e-11 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.001G232700 [exp] 52 / 5e-10 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135400 [exp] 50 / 1e-09 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.006G108100 [exp] 47 / 2e-08 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135700 [exp] 44 / 4e-07 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.009G025200 [exp] 43 / 1e-06 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G136000 [exp] 41 / 7e-06 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024201 pacid=23175787 polypeptide=Lus10024201 locus=Lus10024201.g ID=Lus10024201.BGIv1.0 annot-version=v1.0 ATGGGGGTGCTGGGAGGGGAAGTTCCAGCTGGATGCTGCCAAGGGGTGAAGGACTCGCTGGCAGTCGTGAAGACGACTGAGGATCTGCGGGCGAAATGCC AGTGTGTTAAGGTCGGTGCTCCTGGGATCCCTGGGCTGAACTACACTAGGGTGAATGAGCTCCCTGCCAAATGTGGAACCAAAGAGCTTTACGTTGTTAG CCCCAACACCGATTGCTCCAAGTAA
AA sequence Show only first row Show all	>Lus10024201 pacid=23175787 polypeptide=Lus10024201 locus=Lus10024201.g ID=Lus10024201.BGIv1.0 annot-version=v1.0 MGVLGGEVPAGCCQGVKDSLAVVKTTEDLRAKCQCVKVGAPGIPGLNYTRVNELPAKCGTKELYVVSPNTDCSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10024201 [exp]	0	1
AT4G19510			Disease resistance protein (TI...		Lus10008209 [exp]	1.7	0.9512
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10009911 [exp]	2.2	0.9318
AT5G14090			unknown protein		Lus10037042 [exp]	2.8	0.9400
AT5G22580			Stress responsive A/B Barrel D...		Lus10009407 [exp]	3.0	0.9379
AT2G43820		SGT1, ATSAGT1, ...	UDP-glucose:salicylic acid glu...		Lus10020556 [exp]	3.7	0.9257
AT5G22580			Stress responsive A/B Barrel D...		Lus10020555 [exp]	4.9	0.9367
AT1G27990			unknown protein		Lus10015763 [exp]	8.8	0.9097
AT3G12490		ATCYS6, ATCYSB	ARABIDOPSIS THALIANA PHYTOCYST...		Lus10026779 [exp]	9.0	0.9182
AT2G41110		ACAM-2, ATCAL5,...	calmodulin 2 (.1.2)		Lus10021487 [exp]	11.3	0.9254
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10016227 [exp]	11.8	0.8435

Compare expression of checked genes

Lus10024201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.