Lus10024205 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14550 212 / 2e-69 Peroxidase superfamily protein (.1)
AT1G14540 210 / 1e-68 Peroxidase superfamily protein (.1)
AT5G05340 200 / 1e-64 Peroxidase superfamily protein (.1)
AT5G58400 186 / 3e-59 Peroxidase superfamily protein (.1)
AT5G58390 167 / 1e-51 Peroxidase superfamily protein (.1)
AT4G36430 135 / 3e-39 Peroxidase superfamily protein (.1)
AT2G18140 134 / 5e-39 Peroxidase superfamily protein (.1)
AT5G66390 134 / 9e-39 Peroxidase superfamily protein (.1)
AT2G18150 134 / 9e-39 Peroxidase superfamily protein (.1)
AT3G50990 132 / 6e-38 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024209 313 / 1e-108 AT1G14550 432 / 3e-153 Peroxidase superfamily protein (.1)
Lus10009898 222 / 2e-73 AT1G14550 448 / 1e-159 Peroxidase superfamily protein (.1)
Lus10009900 221 / 1e-72 AT1G14550 436 / 1e-154 Peroxidase superfamily protein (.1)
Lus10009902 218 / 1e-71 AT1G14550 441 / 8e-157 Peroxidase superfamily protein (.1)
Lus10024208 217 / 3e-71 AT1G14550 442 / 3e-157 Peroxidase superfamily protein (.1)
Lus10030148 195 / 4e-63 AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1)
Lus10009933 196 / 6e-63 AT5G05340 364 / 2e-126 Peroxidase superfamily protein (.1)
Lus10034207 181 / 4e-57 AT5G05340 454 / 8e-162 Peroxidase superfamily protein (.1)
Lus10024207 179 / 4e-57 AT1G14550 322 / 2e-110 Peroxidase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G458700 252 / 3e-85 AT1G14540 394 / 4e-138 Peroxidase superfamily protein (.1)
Potri.001G458900 247 / 5e-83 AT1G14540 389 / 3e-136 Peroxidase superfamily protein (.1)
Potri.010G236870 222 / 3e-73 AT1G14550 409 / 3e-144 Peroxidase superfamily protein (.1)
Potri.010G236890 222 / 3e-73 AT1G14550 417 / 3e-147 Peroxidase superfamily protein (.1)
Potri.010G236900 220 / 2e-72 AT1G14550 407 / 2e-143 Peroxidase superfamily protein (.1)
Potri.010G236910 215 / 2e-70 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.010G236850 215 / 2e-70 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.008G022248 211 / 5e-69 AT1G14540 404 / 3e-142 Peroxidase superfamily protein (.1)
Potri.008G022501 211 / 9e-69 AT1G14550 434 / 3e-154 Peroxidase superfamily protein (.1)
Potri.008G022232 211 / 9e-69 AT1G14550 401 / 6e-141 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10024205 pacid=23175804 polypeptide=Lus10024205 locus=Lus10024205.g ID=Lus10024205.BGIv1.0 annot-version=v1.0
ATGGTACAACTGTTCGACAACAAAGGGTTGAGCGCACGTGACATGGTGGCCCTGTCTGGGTCCCACACGATCGGACAGGCGAGGTGCGTGACTTTCCGGG
GGAGGATTTATAGTAACGGTTCGGATATAGACGCTAACTTTGCGAGCACGAGGAGAAGGCAGTGTCCTAATTCTTCTGATGGAAATGGAGATGGCAATTT
GGCGGCTATGGATTTGGTCACTCCCAACTCTTTCGATAATAACTACTTCAGGAATCTGATGCAAAGGAGGGGGCTTCTCCAATCTGATCAGGTGCTTTTC
AGCGGTGGGTCGACTGACGGAATAGTGCAAGAGTATAGTAGGAACCCCAGAGTTTTCACCTCCGATTTCGCGGCTGCTATGGTTCGGATGGGTGATATTG
ACCCATTGACTGGTTCTCAGGGCCAAGTTCGCAGAGTTTGCAGCGTAGCCAACGCTTCCTGA
AA sequence
>Lus10024205 pacid=23175804 polypeptide=Lus10024205 locus=Lus10024205.g ID=Lus10024205.BGIv1.0 annot-version=v1.0
MVQLFDNKGLSARDMVALSGSHTIGQARCVTFRGRIYSNGSDIDANFASTRRRQCPNSSDGNGDGNLAAMDLVTPNSFDNNYFRNLMQRRGLLQSDQVLF
SGGSTDGIVQEYSRNPRVFTSDFAAAMVRMGDIDPLTGSQGQVRRVCSVANAS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G14550 Peroxidase superfamily protein... Lus10024205 0 1
AT1G14550 Peroxidase superfamily protein... Lus10024209 1.0 0.9973
AT1G55230 Family of unknown function (DU... Lus10013749 2.4 0.9825
AT1G03495 HXXXD-type acyl-transferase fa... Lus10020714 3.0 0.9756
AT1G14205 Ribosomal L18p/L5e family prot... Lus10012820 3.5 0.9776
AT3G05950 RmlC-like cupins superfamily p... Lus10032017 4.9 0.9760
AT1G22810 AP2_ERF Integrase-type DNA-binding sup... Lus10009468 5.1 0.9607
Lus10000527 5.9 0.9779
AT4G36220 CYP84A1, FAH1, ... ferulic acid 5-hydroxylase 1 (... Lus10012583 6.0 0.9784
AT3G22370 AtHSR3, ATAOX1A... hyper-sensitivity-related 3, a... Lus10035670 6.2 0.9792
AT5G28540 BIP1 heat shock protein 70 (Hsp 70)... Lus10019915 6.7 0.9691

Lus10024205 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.