Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14550 100 / 2e-26 Peroxidase superfamily protein (.1) AT1G14540 98 / 7e-26 Peroxidase superfamily protein (.1) AT5G06720 92 / 2e-23 ATPA2 peroxidase 2 (.1) AT1G44970 92 / 3e-23 Peroxidase superfamily protein (.1) AT5G58400 91 / 3e-23 Peroxidase superfamily protein (.1) AT5G05340 91 / 3e-23 Peroxidase superfamily protein (.1) AT2G18150 88 / 4e-22 Peroxidase superfamily protein (.1) AT4G36430 88 / 7e-22 Peroxidase superfamily protein (.1) AT2G18140 87 / 1e-21 Peroxidase superfamily protein (.1) AT3G50990 87 / 2e-21 Peroxidase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009898 [exp] 138 / 4e-41 AT1G14550 448 / 1e-159 Peroxidase superfamily protein (.1) Lus10009902 [exp] 136 / 1e-40 AT1G14550 441 / 8e-157 Peroxidase superfamily protein (.1) Lus10024208 [exp] 135 / 4e-40 AT1G14550 442 / 3e-157 Peroxidase superfamily protein (.1) Lus10009900 [exp] 121 / 1e-34 AT1G14550 436 / 1e-154 Peroxidase superfamily protein (.1) Lus10024209 [exp] 104 / 4e-28 AT1G14550 432 / 3e-153 Peroxidase superfamily protein (.1) Lus10025255 [exp] 102 / 2e-27 AT5G05340 337 / 2e-115 Peroxidase superfamily protein (.1) Lus10009936 [exp] 94 / 3e-24 AT5G05340 361 / 5e-125 Peroxidase superfamily protein (.1) Lus10030145 [exp] 94 / 5e-24 AT5G05340 353 / 2e-121 Peroxidase superfamily protein (.1) Lus10003573 [exp] 93 / 5e-24 AT5G05340 397 / 1e-139 Peroxidase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G458700 [exp] 105 / 1e-28 AT1G14540 394 / 4e-138 Peroxidase superfamily protein (.1) Potri.001G458900 [exp] 105 / 1e-28 AT1G14540 389 / 3e-136 Peroxidase superfamily protein (.1) Potri.010G236850 [exp] 103 / 3e-28 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1) Potri.010G236910 [exp] 103 / 3e-28 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1) Potri.010G236890 [exp] 103 / 8e-28 AT1G14550 417 / 3e-147 Peroxidase superfamily protein (.1) Potri.010G236870 [exp] 102 / 1e-27 AT1G14550 409 / 3e-144 Peroxidase superfamily protein (.1) Potri.010G236900 [exp] 102 / 1e-27 AT1G14550 407 / 2e-143 Peroxidase superfamily protein (.1) Potri.008G022232 [exp] 102 / 2e-27 AT1G14550 401 / 6e-141 Peroxidase superfamily protein (.1) Potri.008G022700 [exp] 100 / 5e-27 AT1G14540 404 / 4e-142 Peroxidase superfamily protein (.1) Potri.008G022248 [exp] 100 / 6e-27 AT1G14540 404 / 3e-142 Peroxidase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0617 [flax] [poplar] Peroxidase PF00141 [flax] [poplar] peroxidase Peroxidase
Representative CDS sequence Show only first row Show all	>Lus10024206 pacid=23175732 polypeptide=Lus10024206 locus=Lus10024206.g ID=Lus10024206.BGIv1.0 annot-version=v1.0 ATGGCCAAATCATCATTCTCGGTACTGTTGTTACTCATGCTGCTGAGTATTGCAATAAGCCAGTCCGAAGCACAACAACAGCTGTCCACCAACTTCTATG CCAATTCATGCCCCAATGCTCTCTCTACCATAAGGAGATCCATCACCACTGCCATCTCCAGGGAGCGAAGAATGGCCGCGTCTCTCCTCCGTCTCCATTT CCACGACTGCTTCGTCCAAGGATGCGACGCTTCCATATTGCTCGACCAATCCCCGACCATCCAATCCGAGAAAATGGCTGCTCCGACACTACTACTACTG ACTAAGGACCAATCATAA
AA sequence Show only first row Show all	>Lus10024206 pacid=23175732 polypeptide=Lus10024206 locus=Lus10024206.g ID=Lus10024206.BGIv1.0 annot-version=v1.0 MAKSSFSVLLLLMLLSIAISQSEAQQQLSTNFYANSCPNALSTIRRSITTAISRERRMAASLLRLHFHDCFVQGCDASILLDQSPTIQSEKMAAPTLLLL TKDQS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G14550			Peroxidase superfamily protein...		Lus10024206 [exp]	0	1
AT2G37890			Mitochondrial substrate carrie...		Lus10036193 [exp]	2.8	0.7807
AT4G14746			unknown protein		Lus10025761 [exp]	9.8	0.6892
AT3G47570			Leucine-rich repeat protein ki...		Lus10035429 [exp]	18.2	0.6421
AT2G21610		PE11, ATPE11	A. THALIANA PECTINESTERASE 11,...		Lus10042315 [exp]	19.8	0.6719
					Lus10010271 [exp]	21.1	0.7143
AT1G01390			UDP-Glycosyltransferase superf...		Lus10005335 [exp]	23.5	0.6501
AT3G07840			Pectin lyase-like superfamily ...		Lus10011030 [exp]	25.6	0.7063
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Lus10009924 [exp]	25.8	0.6627
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001037 [exp]	28.1	0.6346
AT5G17680			disease resistance protein (TI...		Lus10028043 [exp]	38.4	0.6398

Compare expression of checked genes

Lus10024206 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.