Lus10024208 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14550 431 / 9e-153 Peroxidase superfamily protein (.1)
AT1G14540 429 / 5e-152 Peroxidase superfamily protein (.1)
AT5G05340 368 / 9e-128 Peroxidase superfamily protein (.1)
AT5G58400 356 / 5e-123 Peroxidase superfamily protein (.1)
AT5G58390 319 / 7e-109 Peroxidase superfamily protein (.1)
AT4G36430 306 / 1e-103 Peroxidase superfamily protein (.1)
AT2G18150 295 / 7e-99 Peroxidase superfamily protein (.1)
AT2G18140 292 / 7e-98 Peroxidase superfamily protein (.1)
AT5G66390 287 / 8e-96 Peroxidase superfamily protein (.1)
AT5G06720 285 / 6e-95 ATPA2 peroxidase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009902 615 / 0 AT1G14550 441 / 8e-157 Peroxidase superfamily protein (.1)
Lus10009898 594 / 0 AT1G14550 448 / 1e-159 Peroxidase superfamily protein (.1)
Lus10009900 560 / 0 AT1G14550 436 / 1e-154 Peroxidase superfamily protein (.1)
Lus10024209 417 / 8e-147 AT1G14550 432 / 3e-153 Peroxidase superfamily protein (.1)
Lus10009899 360 / 1e-124 AT1G14550 367 / 2e-127 Peroxidase superfamily protein (.1)
Lus10034207 335 / 5e-115 AT5G05340 454 / 8e-162 Peroxidase superfamily protein (.1)
Lus10030148 333 / 1e-114 AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1)
Lus10030149 335 / 4e-114 AT5G05340 405 / 8e-142 Peroxidase superfamily protein (.1)
Lus10024207 329 / 2e-113 AT1G14550 322 / 2e-110 Peroxidase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G236850 471 / 7e-169 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.010G236910 471 / 7e-169 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.010G236870 468 / 2e-167 AT1G14550 409 / 3e-144 Peroxidase superfamily protein (.1)
Potri.010G236900 466 / 1e-166 AT1G14550 407 / 2e-143 Peroxidase superfamily protein (.1)
Potri.010G236890 456 / 9e-163 AT1G14550 417 / 3e-147 Peroxidase superfamily protein (.1)
Potri.008G022232 454 / 6e-162 AT1G14550 401 / 6e-141 Peroxidase superfamily protein (.1)
Potri.008G022700 453 / 1e-161 AT1G14540 404 / 4e-142 Peroxidase superfamily protein (.1)
Potri.008G022248 453 / 1e-161 AT1G14540 404 / 3e-142 Peroxidase superfamily protein (.1)
Potri.008G022501 451 / 9e-161 AT1G14550 434 / 3e-154 Peroxidase superfamily protein (.1)
Potri.001G458700 426 / 9e-151 AT1G14540 394 / 4e-138 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10024208 pacid=23175805 polypeptide=Lus10024208 locus=Lus10024208.g ID=Lus10024208.BGIv1.0 annot-version=v1.0
ATGGCCAAATCAGCATTTTGGGCACTGTTACTCATGCTTCTGAGAATTGCAATAAGCCAGTCCCAAGCACAACAACAACTGTCCACAAACTTCTACGCCA
ATTCATGTCCCAATGCTCTCTCCACCATAAGGAGATCCATCACCACTGCCATCTCCAGGGAGCGAAGAATGGCCGCGTCTCTACTTCGTCTTCATTTCCA
CGACTGCTTTGTCCAAGGATGCGATGCTTCCATATTGCTCGACCAAACACCGACCATCGAATCTGAGAAAACCGCTGCTCCAAATGACAAATCAGCTCGA
GGCTACAAAGTCATCGATGCTGCCAAGGCCCAGGTGGAGAGGATATGCCCTGGCGTTGTGTCCTGCGCGGACATTATCGCGGTTGCTGCCAGAGACGCTT
CTGCATATGTGGGAGGCCCCTCTTGGAACGTGAAGCTTGGCAGAAGAGATTCGACTTCTGCTTTCCCTGATATGGCTCTTACTGACTTGCCGTTCTTCAA
AGAGGACCTTCAATCTCTTATCGATCGGTTCCAGGGGAAAGGGCTTAGCCCTAGAGACATGGTCGCACTCTCTGGGGCTCATACTTTGGGTCAAGCTCAA
TGCTTCACCTTTCGCGATAGAATTTATAGCAATGGTACCGACATTGATGCTGGATTCGCGAGCACAAGAAGACGTAGATGCCCTGTGGAAGGGGGAGACG
AGACGTTAGCCCCGTTAGATTTGGTGACGCCCAACTCGTTTGATAATAACTACTTCAGGGATCTAGTGCAGAGGAAGGGACTCCTTGTAACCGACCAGGT
TCTCTTCAATGGGGGCTCTACTGATAGTATTGTGCTAGAGTACAGCAGGAACCGAGCCAGGTTCAATGGCGATTTCGCCGCTGCCATGATTAGGATGGGT
GACATCCAACCATTAACCGGTTCTGCTGGGCAAATCAGGAGGATATGTGGCGCCGTCAACAACTGA
AA sequence
>Lus10024208 pacid=23175805 polypeptide=Lus10024208 locus=Lus10024208.g ID=Lus10024208.BGIv1.0 annot-version=v1.0
MAKSAFWALLLMLLRIAISQSQAQQQLSTNFYANSCPNALSTIRRSITTAISRERRMAASLLRLHFHDCFVQGCDASILLDQTPTIESEKTAAPNDKSAR
GYKVIDAAKAQVERICPGVVSCADIIAVAARDASAYVGGPSWNVKLGRRDSTSAFPDMALTDLPFFKEDLQSLIDRFQGKGLSPRDMVALSGAHTLGQAQ
CFTFRDRIYSNGTDIDAGFASTRRRRCPVEGGDETLAPLDLVTPNSFDNNYFRDLVQRKGLLVTDQVLFNGGSTDSIVLEYSRNRARFNGDFAAAMIRMG
DIQPLTGSAGQIRRICGAVNN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G14550 Peroxidase superfamily protein... Lus10024208 0 1
AT5G57510 unknown protein Lus10033559 1.0 0.9823
AT5G39130 RmlC-like cupins superfamily p... Lus10000622 2.6 0.9770
AT2G19070 SHT spermidine hydroxycinnamoyl tr... Lus10021394 3.5 0.9811
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Lus10038200 5.2 0.9814
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10008917 7.6 0.9822
AT3G26330 CYP71B37 "cytochrome P450, family 71, s... Lus10010545 13.0 0.9748
AT5G40690 unknown protein Lus10015261 13.7 0.9379
AT5G43440 2-oxoglutarate (2OG) and Fe(II... Lus10022192 16.6 0.9780
AT3G26330 CYP71B37 "cytochrome P450, family 71, s... Lus10033633 18.2 0.9779
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Lus10003147 21.4 0.9659

Lus10024208 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.