Lus10024211 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G26665 258 / 2e-88 Mediator complex, subunit Med10 (.1.2)
AT5G41910 238 / 8e-81 MED10A Mediator complex, subunit Med10 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009896 306 / 3e-99 AT2G24370 632 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G083801 287 / 3e-100 AT1G26665 265 / 2e-91 Mediator complex, subunit Med10 (.1.2)
Potri.003G146900 285 / 1e-99 AT1G26665 274 / 5e-95 Mediator complex, subunit Med10 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09748 Med10 Transcription factor subunit Med10 of Mediator complex
Representative CDS sequence
>Lus10024211 pacid=23175730 polypeptide=Lus10024211 locus=Lus10024211.g ID=Lus10024211.BGIv1.0 annot-version=v1.0
ATGGATACTTCACAGAACATTGTCGGAGGGAACGGTGGCAATGGCGTATTGTCTGCCCAGGAAAATGATACTACTAACTCTGCAACAGCACCAGCCAATG
ATCCAAAGGAAAATCTGAACCAGGTTATTAACTCAATTCAGAAGATTCTTGGCTACATCCATCAGCTTTACCTCACTGTCTCCTCGTTCAATGCTGCCTC
TCAGGCTCCTCTCCTGCAGCGCCTCAATTTACTCATGACAGAGCTAGACAATATGGAGAAACTCTCTGAGAAGTGCAATATTCAAGTTCCCATGGAGGTT
CTTAGTTTAATTGATGATGGAAAAAATCCAGATGAATTCACACGGGATGTCATAAACAGTTGCATTGCGAAAAATCAAGTTACCAAGGGGAAAACTGATG
CCTTTAAGGCTCTACGTAAAAATCTCTTGGACGAACTTGAGCAGGCTTTTCCCGATGAAGTTGAATCATACAGGGAAATACGTGCAATTTCTGCTGCTGA
AACAAAACGCCTTGCTCAAGCACAAAGTTCGTTGCCAAATGGAGACATGAAGGTGAAACCTGAGGTTTAA
AA sequence
>Lus10024211 pacid=23175730 polypeptide=Lus10024211 locus=Lus10024211.g ID=Lus10024211.BGIv1.0 annot-version=v1.0
MDTSQNIVGGNGGNGVLSAQENDTTNSATAPANDPKENLNQVINSIQKILGYIHQLYLTVSSFNAASQAPLLQRLNLLMTELDNMEKLSEKCNIQVPMEV
LSLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKALRKNLLDELEQAFPDEVESYREIRAISAAETKRLAQAQSSLPNGDMKVKPEV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G26665 Mediator complex, subunit Med1... Lus10024211 0 1
AT4G33740 unknown protein Lus10020507 5.6 0.9214
AT3G50120 Plant protein of unknown funct... Lus10010064 8.2 0.9122
AT5G53530 VPS26A vacuolar protein sorting 26A (... Lus10023242 9.0 0.9019
AT1G66540 Cytochrome P450 superfamily pr... Lus10032856 9.5 0.9034
AT2G32080 PUR ALPHA-1, PU... purin-rich alpha 1 (.1.2) Lus10001782 13.2 0.9033
AT1G03280 Transcription factor TFIIE, al... Lus10011554 14.1 0.8926
AT1G63380 NAD(P)-binding Rossmann-fold s... Lus10007038 16.7 0.9066
AT5G27600 LACS7, ATLACS7 long-chain acyl-CoA synthetase... Lus10029918 17.8 0.9065
AT1G49390 2-oxoglutarate (2OG) and Fe(II... Lus10008824 17.9 0.9019
AT3G49150 F-box/RNI-like superfamily pro... Lus10025561 18.3 0.9039

Lus10024211 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.