Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G69588 40 / 2e-05 CLE45 CLAVATA3/ESR-RELATED 45 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002061 [exp] 162 / 6e-54 ND 37 / 5e-04 Lus10037173 [exp] 57 / 4e-12 ND 40 / 4e-05
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G169300 [exp] 76 / 2e-19 AT1G69588 57 / 1e-11 CLAVATA3/ESR-RELATED 45 (.1) Potri.008G086100 [exp] 73 / 2e-18 AT1G69588 52 / 7e-10 CLAVATA3/ESR-RELATED 45 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024213 pacid=23175773 polypeptide=Lus10024213 locus=Lus10024213.g ID=Lus10024213.BGIv1.0 annot-version=v1.0 ATGGGTTTAAGAGTGATTCTCCTACTCTTCTGCATTGGAAATTTAGCTCTTCAACCGGAAAAGGCTTCTGCATTGACAAACATCGATCTTGTGCTGAGAT GGCCGTATCCTGACTCGCTGCCGCTGTCTCAACATTCTTCGCGTATCCTGAAAGATGTGTCTGTGGATGATTTGCAGACGAGATTTATAAATATGGCACC GGCGCCTTCAATGATGTTCGACCCTAACCAATCCAACAAAAGAACGGTTAAGAAAGGATCCGATCCCATCCACAACAGACAGTAG
AA sequence Show only first row Show all	>Lus10024213 pacid=23175773 polypeptide=Lus10024213 locus=Lus10024213.g ID=Lus10024213.BGIv1.0 annot-version=v1.0 MGLRVILLLFCIGNLALQPEKASALTNIDLVLRWPYPDSLPLSQHSSRILKDVSVDDLQTRFINMAPAPSMMFDPNQSNKRTVKKGSDPIHNRQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10024213 [exp]	0	1
					Lus10002061 [exp]	1.0	0.8974
AT5G28650	WRKY	ATWRKY74, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10021999 [exp]	2.2	0.8756
AT5G28650	WRKY	ATWRKY74, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10042538 [exp]	2.4	0.8967
AT5G26990			Drought-responsive family prot...		Lus10017956 [exp]	2.4	0.8689
AT3G52490			Double Clp-N motif-containing ...		Lus10016966 [exp]	6.7	0.8949
AT3G52490			Double Clp-N motif-containing ...		Lus10021291 [exp]	9.4	0.8764
AT5G01310	bHLH	APTX, bHLH140	APRATAXIN-like (.1)		Lus10002213 [exp]	11.8	0.8598
AT2G37590	DOF	AtDof2. 4, ATDO...	DNA binding with one finger 2....		Lus10025340 [exp]	14.5	0.8432
AT2G27035		AtENODL20	early nodulin-like protein 20 ...		Lus10005229 [exp]	14.7	0.8612
AT5G62890			Xanthine/uracil permease famil...		Lus10010707 [exp]	15.0	0.8602

Compare expression of checked genes

Lus10024213 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.