Gene [FLAX] | FIBexDB

Lus10024224 [FLAX]

External link

JGI Phytozome v13

[genome browser]

Symbol

Arabidopsis homologues

Show only best Show top 10

No hit found

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10002053 [exp]	115 / 9e-31	AT5G62440	98 / 2e-23	Protein of unknown function (DUF3223) (.1)
Lus10023594 [exp]	68 / 5e-14	AT5G62440	96 / 1e-23	Protein of unknown function (DUF3223) (.1)
Lus10025581 [exp]	57 / 6e-10	AT3G07565	155 / 2e-46	Protein of unknown function (DUF3755) (.1), Protein of unknown function (DUF3755) (.2), Protein of unknown function (DUF3755) (.3), Protein of unknown function (DUF3755) (.4)

Poplar homologues

Show only best Show top 10

No hit found

PFAM info

Representative CDS sequence

Show only first row Show all

>Lus10024224 pacid=23175777 polypeptide=Lus10024224 locus=Lus10024224.g ID=Lus10024224.BGIv1.0 annot-version=v1.0

ATGGCAGTCGTCACCATGCCATCTACAATGCCTGCATTTGCAACAATCAAGATCCCCTGCCACATCGGAAAGCCAACTGGGTCAGCTTCATGTCATCTCC

AACCCCGTGCTTCGGACGACAACGTGATCGCTGCACCCCGCCAAACAAACTGGCAGACCAAGCCGATCCTGATTCCACCTCCGCACGTGCACCCACTATG

TCTAGCTGTCCTGAAACGAGCCAACGGAACCGATGATGCCTGTAAGAAGAAGCAGAAGGGGGAAACCGGAGATGAGAAGTCTGCGGAGAAGGAGAAGGAG

AAGGAGAAGGAGAAACTAGTGTATTTCATGAATCCGGGGTTATACATGACTCCCCGTCGATGGATTTACCATTTTGACCAGTTGCTTGGCACATGCCTTG

TCAATATCCCTATCCTACTTGATTATAGAGGCAAAGATCTGTTGGAGCTTACCGAATGA

AA sequence

Show only first row Show all

>Lus10024224 pacid=23175777 polypeptide=Lus10024224 locus=Lus10024224.g ID=Lus10024224.BGIv1.0 annot-version=v1.0

MAVVTMPSTMPAFATIKIPCHIGKPTGSASCHLQPRASDDNVIAAPRQTNWQTKPILIPPPHVHPLCLAVLKRANGTDDACKKKQKGETGDEKSAEKEKE

KEKEKLVYFMNPGLYMTPRRWIYHFDQLLGTCLVNIPILLDYRGKDLLELTE

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10024224 [exp]	0	1

Lus10024224 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.