Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38240 51 / 4e-09 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G11180 50 / 1e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT2G44800 48 / 8e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G63590 47 / 1e-07 ATFLS3, FLS3, FLS flavonol synthase 3 (.1) AT5G08640 47 / 2e-07 ATFLS1, FLS flavonol synthase 1 (.1.2) AT3G55970 47 / 2e-07 ATJRG21 jasmonate-regulated gene 21 (.1) AT5G63600 47 / 2e-07 ATFLS5, FLS5 flavonol synthase 5 (.1.2) AT2G36690 47 / 2e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G46490 47 / 2e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G55290 46 / 3e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023602 [exp] 105 / 5e-29 AT3G11180 158 / 5e-45 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10024230 [exp] 93 / 3e-24 AT3G19000 149 / 3e-42 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10007820 [exp] 50 / 1e-08 AT4G16770 291 / 4e-98 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10035782 [exp] 50 / 1e-08 AT5G24530 258 / 4e-84 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10031150 [exp] 49 / 3e-08 AT4G10490 114 / 1e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10006518 [exp] 49 / 4e-08 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023851 [exp] 49 / 5e-08 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004245 [exp] 48 / 5e-08 AT3G19010 277 / 2e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Lus10011981 [exp] 48 / 8e-08 AT1G17020 375 / 2e-129 senescence-related gene 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G069200 [exp] 58 / 2e-11 AT3G19000 147 / 2e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.006G101100 [exp] 54 / 5e-10 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101200 [exp] 52 / 2e-09 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.016G117100 [exp] 52 / 2e-09 AT5G05600 491 / 4e-175 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.009G107600 [exp] 51 / 5e-09 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107550 [exp] 51 / 6e-09 AT3G19000 452 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.001G080600 [exp] 50 / 1e-08 AT5G07480 453 / 9e-161 KAR-UP oxidoreductase 1 (.1) Potri.015G002800 [exp] 49 / 2e-08 AT5G24530 521 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.012G006300 [exp] 49 / 3e-08 AT5G24530 506 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G231500 [exp] 49 / 4e-08 AT2G36690 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024231 pacid=23175744 polypeptide=Lus10024231 locus=Lus10024231.g ID=Lus10024231.BGIv1.0 annot-version=v1.0 ATGGCTCCTGAAATTGTTAGCATTCCTGTGGTGGATCTCTCACCTTTCTTCTCCTCTTCCGACGGCTCCGACGACGACGACCAGCTGATATTGAAGAAGG AAAAGGTGTTGGAGACGGTGAAGAAAGCATGCTCCGAGTACGGATTCTTCCGGATAGTCAACAACGGGGTATCCACTGAACTCATGAAGCGTGCTCTCCA AGTTTCCAAGTCATTCTTCGACCTCCCAGACGAGGAGAAGCGCAAGTAA
AA sequence Show only first row Show all	>Lus10024231 pacid=23175744 polypeptide=Lus10024231 locus=Lus10024231.g ID=Lus10024231.BGIv1.0 annot-version=v1.0 MAPEIVSIPVVDLSPFFSSSDGSDDDDQLILKKEKVLETVKKACSEYGFFRIVNNGVSTELMKRALQVSKSFFDLPDEEKRK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G36690			2-oxoglutarate (2OG) and Fe(II...		Lus10024231 [exp]	0	1
					Lus10010827 [exp]	2.0	1.0000
AT1G15550		ATGA3OX1, GA4	GA REQUIRING 4, ARABIDOPSIS TH...		Lus10013135 [exp]	2.8	1.0000
					Lus10005843 [exp]	3.5	1.0000
					Lus10022511 [exp]	4.0	1.0000
AT5G17490	GRAS	AtRGL3, RGL3	RGA-like protein 3 (.1)		Lus10002424 [exp]	5.0	1.0000
AT4G21390		B120	S-locus lectin protein kinase ...		Lus10032836 [exp]	5.5	1.0000
AT2G37010		ATNAP12	non-intrinsic ABC protein 12 (...		Lus10023020 [exp]	5.5	0.8872
					Lus10040033 [exp]	5.7	0.9466
AT1G31550			GDSL-like Lipase/Acylhydrolase...		Lus10026550 [exp]	5.7	0.9902
AT1G01580		FRD1, ATFRO2, F...	FERRIC CHELATE REDUCTASE DEFEC...		Lus10036381 [exp]	5.9	1.0000

Compare expression of checked genes

Lus10024231 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.