Lus10024232 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20950 110 / 2e-28 Glycosyl hydrolase family protein (.1.2)
AT5G04885 100 / 7e-25 Glycosyl hydrolase family protein (.1)
AT5G20940 89 / 5e-21 Glycosyl hydrolase family protein (.1)
AT3G47040 88 / 1e-20 Glycosyl hydrolase family protein (.1.2)
AT3G47010 86 / 5e-20 Glycosyl hydrolase family protein (.1.2)
AT3G47000 83 / 7e-19 Glycosyl hydrolase family protein (.1)
AT3G47050 79 / 1e-17 Glycosyl hydrolase family protein (.1.2)
AT3G62710 73 / 2e-15 Glycosyl hydrolase family protein (.1)
AT2G30840 58 / 2e-10 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G30830 54 / 9e-09 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023604 142 / 1e-39 AT5G20950 822 / 0.0 Glycosyl hydrolase family protein (.1.2)
Lus10022413 124 / 3e-33 AT5G20950 837 / 0.0 Glycosyl hydrolase family protein (.1.2)
Lus10001151 119 / 2e-31 AT5G20950 911 / 0.0 Glycosyl hydrolase family protein (.1.2)
Lus10023602 114 / 5e-31 AT3G11180 158 / 5e-45 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10008432 108 / 7e-28 AT5G20950 927 / 0.0 Glycosyl hydrolase family protein (.1.2)
Lus10013390 108 / 1e-27 AT5G20950 935 / 0.0 Glycosyl hydrolase family protein (.1.2)
Lus10010657 99 / 1e-24 AT5G20950 889 / 0.0 Glycosyl hydrolase family protein (.1.2)
Lus10005706 99 / 3e-24 AT5G04885 863 / 0.0 Glycosyl hydrolase family protein (.1)
Lus10013646 97 / 6e-24 AT5G20950 941 / 0.0 Glycosyl hydrolase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G153900 115 / 3e-30 AT5G20950 937 / 0.0 Glycosyl hydrolase family protein (.1.2)
Potri.013G055600 103 / 6e-26 AT5G20950 932 / 0.0 Glycosyl hydrolase family protein (.1.2)
Potri.019G037400 103 / 6e-26 AT5G20950 926 / 0.0 Glycosyl hydrolase family protein (.1.2)
Potri.008G013500 99 / 2e-24 AT5G04885 966 / 0.0 Glycosyl hydrolase family protein (.1)
Potri.008G013700 98 / 5e-24 AT5G20950 901 / 0.0 Glycosyl hydrolase family protein (.1.2)
Potri.009G154802 89 / 4e-22 AT5G04885 232 / 5e-72 Glycosyl hydrolase family protein (.1)
Potri.005G059200 84 / 7e-20 AT5G04885 385 / 8e-131 Glycosyl hydrolase family protein (.1)
Potri.009G042800 80 / 9e-18 AT3G47000 934 / 0.0 Glycosyl hydrolase family protein (.1)
Potri.012G069200 73 / 1e-15 AT3G19000 147 / 2e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.009G154032 67 / 6e-14 AT5G20940 254 / 7e-82 Glycosyl hydrolase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10024232 pacid=23175746 polypeptide=Lus10024232 locus=Lus10024232.g ID=Lus10024232.BGIv1.0 annot-version=v1.0
ATGACCCAACTTCACTATTTCCCAACGATTTCGGACGTCGAGAACGAAGGTAACTCACCCCATGAGGACACCAATTGCGTCACCATTATGTTCCAGGACG
ATACTGGAGGGTTCGAGGTCCCGAGAGGCAAGGACTGGATTTCTGTCCCTCCCTATCCCAACTCCATGAACGTCAACATTAGAGATGTACTTCAGGTGAT
GATTCCCTATGGATTTAGGGAGTTCATTAGAGACGTGACGTTCCAAGTTGAGAAGAAGATAATCCCAACTTCCAGGATTGATGATGCCGTCTACAGGATT
TTAAGAGTCGAGTTTGCAATGGGGTTGTTTGAGTCGCCACTTAGTGATCTCACCATGGCAAATGAGCTTGGAAAGAAGGAGCATCGAGACTTGGCAAGAG
AAGCGGAGAACCCTAGTGTGAAGTTTATCGAATCAAACGACTTCTCCTATGCCATAGTGGTTGTTGGGGAGCAACCCTATGCAGAAAATATGGGGATAGC
AGGAACCTAA
AA sequence
>Lus10024232 pacid=23175746 polypeptide=Lus10024232 locus=Lus10024232.g ID=Lus10024232.BGIv1.0 annot-version=v1.0
MTQLHYFPTISDVENEGNSPHEDTNCVTIMFQDDTGGFEVPRGKDWISVPPYPNSMNVNIRDVLQVMIPYGFREFIRDVTFQVEKKIIPTSRIDDAVYRI
LRVEFAMGLFESPLSDLTMANELGKKEHRDLAREAENPSVKFIESNDFSYAIVVVGEQPYAENMGIAGT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G20950 Glycosyl hydrolase family prot... Lus10024232 0 1

Lus10024232 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.