Lus10024239 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G26930 147 / 3e-41 Galactose oxidase/kelch repeat superfamily protein (.1)
AT2G02870 139 / 6e-38 Galactose oxidase/kelch repeat superfamily protein (.1.2.3)
AT1G14330 133 / 7e-36 Galactose oxidase/kelch repeat superfamily protein (.1)
AT1G74510 129 / 2e-34 Galactose oxidase/kelch repeat superfamily protein (.1.2)
AT5G11580 102 / 3e-24 Regulator of chromosome condensation (RCC1) family protein (.1)
AT5G60570 92 / 5e-21 Galactose oxidase/kelch repeat superfamily protein (.1)
AT3G27150 81 / 5e-17 Galactose oxidase/kelch repeat superfamily protein (.1)
AT5G40680 74 / 1e-14 Galactose oxidase/kelch repeat superfamily protein (.1)
AT1G22040 64 / 3e-11 Galactose oxidase/kelch repeat superfamily protein (.1)
AT1G67480 57 / 3e-09 Galactose oxidase/kelch repeat superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023608 280 / 1e-92 AT1G26930 353 / 9e-120 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10038724 259 / 9e-83 AT5G11580 629 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1)
Lus10012474 196 / 8e-63 AT1G27060 89 / 2e-21 Regulator of chromosome condensation (RCC1) family protein (.1)
Lus10008730 195 / 1e-61 AT1G27060 132 / 1e-36 Regulator of chromosome condensation (RCC1) family protein (.1)
Lus10036735 153 / 3e-43 AT2G02870 570 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1.2.3)
Lus10012841 152 / 8e-43 AT2G02870 568 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1.2.3)
Lus10030489 150 / 6e-42 AT2G02870 551 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1.2.3)
Lus10037196 147 / 4e-41 AT2G02870 536 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1.2.3)
Lus10037413 105 / 1e-25 AT5G60570 589 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G063200 151 / 2e-42 AT1G74510 529 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1.2)
Potri.018G044400 146 / 9e-40 AT5G11580 578 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1)
Potri.019G042100 114 / 1e-28 AT5G60570 419 / 3e-145 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.013G077800 112 / 8e-28 AT5G60570 402 / 2e-138 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.001G331500 83 / 8e-18 AT3G27150 370 / 2e-125 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.017G069500 76 / 2e-15 AT3G27150 355 / 7e-120 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.001G008000 64 / 3e-11 AT1G55270 731 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.005G170000 62 / 8e-11 AT1G22040 592 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.002G091900 62 / 9e-11 AT1G22040 595 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.003G217700 60 / 7e-10 AT1G55270 733 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10024239 pacid=23175790 polypeptide=Lus10024239 locus=Lus10024239.g ID=Lus10024239.BGIv1.0 annot-version=v1.0
ATGGTGAAGCAATCCTCACTACTGGTGACGGGTAGAAAACAAACGGTTAATGACACCGACTCCAAACCCCAGCCGCTGCTGATAGGTATGCTGGGGCGGG
ACCTATCAATCAGCTGCCTACTCCGCTTACCTAGGATCATATACGACACCGTTTCATCCATCAGCATGAGCTTCAAGTCCGTAATCAAAAGCGGCGAGGT
CTACAAGCTACGACGAAAAGCCGGGATATTCGAACCCTGGGTCTACTTCTCATGCAACATCATGGAATGGGAAGCCTTCGACTCACTCACCAACACCTGG
ATCCGCCTCCAGAAAATGCCATTCGAAAGCTACTTTGCCTTCTCCGATAAGGAGTCCCTCGCCGTCGGGACACACATCCTCGTCTTCGGCCAGGAAGTCC
ACGCCCCGGCAGTGTACAGGTACAGCCTCCTCGAGAACAAGTGGACCACCACCGCCCAAAACCTAACTAAAGTGATGAACACACCTCACGCACATACCGT
TCTTGTTACGGATGGTGGATACAGGCTTTGGTCTTGGGGTAGGGGAAGGAGTGGTGTTCTTGGAAATGGAAAGACTATTGATTTTTACGCCCCTAGTCAT
GTGTTAAGGCCTCCACTAGGTGAGGATTCCAAGGAACAACAGTTCGGTGATGTTAATGAAAAGGATGAAGTTGGAGACGAGGGTTTTGATATTGACAAAA
GACTATCCACTGCAATGGAGGAGATGAAGCTTCTCCGATCCAAATATTCATCGATGGAGCAACACGCTAGCATGCTTCATGGTCTTATTTTTGGTGAACT
TTTAAGGGAACATGAAATTACTAACTCCTGGCAGCAGTCAAGTGGTGTTGATATCACAAGACAATGGGAAGACATGTTAGAATTAGTAGATGAATAA
AA sequence
>Lus10024239 pacid=23175790 polypeptide=Lus10024239 locus=Lus10024239.g ID=Lus10024239.BGIv1.0 annot-version=v1.0
MVKQSSLLVTGRKQTVNDTDSKPQPLLIGMLGRDLSISCLLRLPRIIYDTVSSISMSFKSVIKSGEVYKLRRKAGIFEPWVYFSCNIMEWEAFDSLTNTW
IRLQKMPFESYFAFSDKESLAVGTHILVFGQEVHAPAVYRYSLLENKWTTTAQNLTKVMNTPHAHTVLVTDGGYRLWSWGRGRSGVLGNGKTIDFYAPSH
VLRPPLGEDSKEQQFGDVNEKDEVGDEGFDIDKRLSTAMEEMKLLRSKYSSMEQHASMLHGLIFGELLREHEITNSWQQSSGVDITRQWEDMLELVDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G26930 Galactose oxidase/kelch repeat... Lus10024239 0 1
AT2G20020 CAF1, ATCAF1 RNA-binding CRS1 / YhbY (CRM) ... Lus10034952 1.0 0.9145
Lus10017219 1.7 0.8896
AT5G66550 Maf-like protein (.1) Lus10040204 2.4 0.8940
AT5G51010 Rubredoxin-like superfamily pr... Lus10027889 3.5 0.8632
AT5G02250 ATMTRNASEII, RN... ribonucleotide reductase 1, EM... Lus10010842 4.0 0.8884
AT3G48200 unknown protein Lus10008827 5.9 0.8618
AT1G06510 unknown protein Lus10031459 6.5 0.8283
AT2G25660 EMB2410 embryo defective 2410 (.1) Lus10022111 6.9 0.8551
AT5G04050 RNA-directed DNA polymerase (r... Lus10036278 8.8 0.8401
AT2G39260 binding;RNA binding (.1) Lus10030801 9.9 0.8512

Lus10024239 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.