Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05810 51 / 7e-09 ATL43 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023617 [exp] 119 / 6e-34 AT5G05810 219 / 1e-68 RING/U-box superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G056800 [exp] 62 / 1e-12 AT5G05810 263 / 8e-85 RING/U-box superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024248 pacid=23175726 polypeptide=Lus10024248 locus=Lus10024248.g ID=Lus10024248.BGIv1.0 annot-version=v1.0 ATGCTCTTGACCCGTTCGGAAAGTGGATCGGGCTCCGTTTCACTTTCAACGATTGACAGGACCCGTTTGGAGCATCGGATAATCGTATCGGACGGCCGGC AATACCAAACGCATAGGTGGAGCGACGTACAGCCGTCGGATCGTCTCTATCTACGGTCGGAATTGATCATCAGTAACAGCCGTGGAGTACATTCAGAAAG GAAGCCGCCTCTGCCTCCTTTCCCTCCGCCGCGGCTTCCTCCGTCACAAGTACAAACTACGTCTTAG
AA sequence Show only first row Show all	>Lus10024248 pacid=23175726 polypeptide=Lus10024248 locus=Lus10024248.g ID=Lus10024248.BGIv1.0 annot-version=v1.0 MLLTRSESGSGSVSLSTIDRTRLEHRIIVSDGRQYQTHRWSDVQPSDRLYLRSELIISNSRGVHSERKPPLPPFPPPRLPPSQVQTTS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05810		ATL43	RING/U-box superfamily protein...		Lus10024248 [exp]	0	1
AT1G76890	Trihelix	AT-GT2, GT2	Duplicated homeodomain-like su...		Lus10009184 [exp]	4.5	0.8441
AT1G11820			O-Glycosyl hydrolases family 1...		Lus10031456 [exp]	7.7	0.8415
AT5G63810		BGAL10	beta-galactosidase 10 (.1)		Lus10022645 [exp]	10.2	0.8400
AT3G27120			P-loop containing nucleoside t...		Lus10041563 [exp]	10.7	0.8651
AT1G66150		TMK1	transmembrane kinase 1 (.1)		Lus10010472 [exp]	13.4	0.8219
AT2G34780		EMB1611, MEE22	EMBRYO DEFECTIVE 1611, materna...		Lus10038447 [exp]	21.1	0.8424
AT3G05470			Actin-binding FH2 (formin homo...		Lus10015175 [exp]	22.0	0.8349
AT4G28780			GDSL-like Lipase/Acylhydrolase...		Lus10004770 [exp]	28.7	0.8059
AT3G04290		ATLTL1, LTL1	Li-tolerant lipase 1 (.1)		Lus10003106 [exp]	31.5	0.8221
AT5G07030			Eukaryotic aspartyl protease f...		Lus10026171 [exp]	32.2	0.7722

Compare expression of checked genes

Lus10024248 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.