Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14660 117 / 1e-34 NRPE7 RNA polymerase Rpb7-like, N-terminal domain (.1) AT3G22900 97 / 6e-27 NRPD7 RNA polymerase Rpb7-like, N-terminal domain (.1) AT4G14520 72 / 7e-17 DNA-directed RNA polymerase II-related (.1.2.3) AT5G59180 38 / 0.0003 NRPB7 DNA-directed RNA polymerase II (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023620 [exp] 152 / 1e-48 AT4G14660 205 / 3e-68 RNA polymerase Rpb7-like, N-terminal domain (.1) Lus10023619 [exp] 141 / 4e-44 AT4G14660 266 / 2e-92 RNA polymerase Rpb7-like, N-terminal domain (.1) Lus10024250 [exp] 138 / 6e-43 AT4G14660 263 / 5e-91 RNA polymerase Rpb7-like, N-terminal domain (.1) Lus10004986 [exp] 40 / 4e-05 AT5G59180 325 / 2e-115 DNA-directed RNA polymerase II (.1) Lus10001559 [exp] 40 / 6e-05 AT5G59180 331 / 5e-118 DNA-directed RNA polymerase II (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G161700 [exp] 129 / 2e-39 AT4G14660 293 / 5e-103 RNA polymerase Rpb7-like, N-terminal domain (.1) Potri.010G077300 [exp] 125 / 4e-38 AT4G14660 261 / 3e-90 RNA polymerase Rpb7-like, N-terminal domain (.1) Potri.010G077200 [exp] 96 / 4e-26 AT4G14660 171 / 1e-54 RNA polymerase Rpb7-like, N-terminal domain (.1) Potri.001G377200 [exp] 40 / 5e-05 AT5G59180 340 / 1e-121 DNA-directed RNA polymerase II (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024251 pacid=23175757 polypeptide=Lus10024251 locus=Lus10024251.g ID=Lus10024251.BGIv1.0 annot-version=v1.0 ATGTTTCGTGTGGAATTTAGTGCCATCACATTCAACGTCTTCAGGGGAGAAGTGTTGGAGGGAGTTGTGCAGAAGGTGTTGAAGCATGGGGTGACCTTGA GGTGTGGACCGATCGATAAGGTGTTCCTCTCGCACTCGAAAATGCCTAGATATAACTATGTCTATGGAGAGAACCCTGAGTTTGTGAATGAGAAGATGCC GAAAATTGGGGCTGGTGTGGTGGTTCGGTTCGCGGTGATGGGGACTATGTGGCTTGAGGCAGAGAAGGAGCTGCAGGTACTGGCTACCTGGAAGGAGATT TTCTAG
AA sequence Show only first row Show all	>Lus10024251 pacid=23175757 polypeptide=Lus10024251 locus=Lus10024251.g ID=Lus10024251.BGIv1.0 annot-version=v1.0 MFRVEFSAITFNVFRGEVLEGVVQKVLKHGVTLRCGPIDKVFLSHSKMPRYNYVYGENPEFVNEKMPKIGAGVVVRFAVMGTMWLEAEKELQVLATWKEI F

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14660		NRPE7	RNA polymerase Rpb7-like, N-te...		Lus10024251 [exp]	0	1
AT5G08640		ATFLS1, FLS	flavonol synthase 1 (.1.2)		Lus10025619 [exp]	3.9	0.8130
AT1G75900		EXL3	GDSL-like Lipase/Acylhydrolase...		Lus10034542 [exp]	5.1	0.6745
AT1G18790		AtRKD1, RKD1	RWP-RK domain containing 1, RW...		Lus10019100 [exp]	5.5	0.8130
AT1G61680		ATTPS14	terpene synthase 14 (.1.2)		Lus10040632 [exp]	6.7	0.8130
AT2G32300		UCC1	uclacyanin 1 (.1)		Lus10007025 [exp]	7.5	0.8055
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10005010 [exp]	8.7	0.7937
AT4G21330	bHLH	bHLH022, DYT1	DYSFUNCTIONAL TAPETUM 1, basic...		Lus10007618 [exp]	9.8	0.7855
AT1G09790		COBL6	COBRA-like protein 6 precursor...		Lus10016188 [exp]	11.2	0.7547
AT1G27060			Regulator of chromosome conden...		Lus10012474 [exp]	14.0	0.6683
					Lus10016947 [exp]	17.0	0.6072

Compare expression of checked genes

Lus10024251 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.