Lus10024257 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029847 184 / 9e-55 AT2G24100 160 / 6e-42 ALTERED SEED GERMINATION 1, unknown protein
Lus10020694 142 / 1e-40 AT2G24100 145 / 5e-38 ALTERED SEED GERMINATION 1, unknown protein
Lus10011275 82 / 1e-21 ND /
Lus10029846 77 / 3e-17 AT2G24100 137 / 2e-35 ALTERED SEED GERMINATION 1, unknown protein
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10024257 pacid=23175727 polypeptide=Lus10024257 locus=Lus10024257.g ID=Lus10024257.BGIv1.0 annot-version=v1.0
ATGAATCACTTACCTCATTACAATCCTGCTCAGGGTTCCAATCATCAGAATGTTGATTCCATCGCATTGCCTCCTCCTCAGAATGAGCTCTATCACCAAG
TTCTAATAGAGGAGCGTTTTTGGGAAGTCCCTCTTAGGTTGAAGCTCGATAAATCCCCGGACTTCCTAAGCTTGGTGGAGAGGAACCTGAATCATGATCA
TCAACATATTACTGAATTGAAAAGGAAGTCGAGGCTCGACAAATATGGTTCCCTGTCGGTGGATGCCTCTAATCAGAAGTTGAAAGCTTCAACCATTCTG
GCCTCAGATGAGAAGTTGAAAGCTTTAAGCATTCTAGACAATGTGATAGTTCCTATCGAGGCTACTTATCTAATAGCACAGTGTTACTGCAATGAGAAGA
AGCTGGCGTGA
AA sequence
>Lus10024257 pacid=23175727 polypeptide=Lus10024257 locus=Lus10024257.g ID=Lus10024257.BGIv1.0 annot-version=v1.0
MNHLPHYNPAQGSNHQNVDSIALPPPQNELYHQVLIEERFWEVPLRLKLDKSPDFLSLVERNLNHDHQHITELKRKSRLDKYGSLSVDASNQKLKASTIL
ASDEKLKALSILDNVIVPIEATYLIAQCYCNEKKLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10024257 0 1
AT5G23660 MTN3, SWEET12, ... homolog of Medicago truncatula... Lus10024770 11.4 0.7903
AT5G23660 MTN3, SWEET12, ... homolog of Medicago truncatula... Lus10009782 22.7 0.7750
AT4G12840 Protein of unknown function (D... Lus10008748 37.7 0.7577
Lus10003450 77.2 0.7434
AT1G13620 RGF2 root meristem growth factor 2,... Lus10019202 94.9 0.7301
AT5G14920 Gibberellin-regulated family p... Lus10014519 104.5 0.7225
Lus10022643 112.0 0.7285
AT4G12320 CYP706A6 "cytochrome P450, family 706, ... Lus10028914 114.3 0.7283
AT1G73210 Protein of unknown function (D... Lus10018267 117.7 0.6957
AT2G25180 GARP ARR12 response regulator 12 (.1) Lus10019058 275.6 0.6768

Lus10024257 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.