Lus10024262 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G71750 259 / 3e-89 HGPT Hypoxanthine-guanine phosphoribosyltransferase (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023627 360 / 5e-129 AT1G71750 264 / 4e-91 Hypoxanthine-guanine phosphoribosyltransferase (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G198400 315 / 4e-111 AT1G71750 270 / 3e-93 Hypoxanthine-guanine phosphoribosyltransferase (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0533 PRTase-like PF00156 Pribosyltran Phosphoribosyl transferase domain
Representative CDS sequence
>Lus10024262 pacid=23175760 polypeptide=Lus10024262 locus=Lus10024262.g ID=Lus10024262.BGIv1.0 annot-version=v1.0
ATGGCTCTGGACTCTCACATAGACAAGGTCCTATGGAGCGCAGTCCAAATCTCCGACCGAGTCGCCAGTCTCGCTGCGGAGATCGCCGCCGATTTCTCCC
CTGATTCACCTGCTCCGGTCCTCGTTGGAGTCGCTACTGGCGCATTCATCTTCCTGGCTGACTTGGCCAGGGAAATCAAGCTCCCGATTTCCGTGGATTT
CATTCGAGCCGATTCCTATGGCTCCGGGACCGAGTCGAGCGGCGCCCCTAGGGTTTCTCTCGACCTGAAGTTGGACGTGAAGGGGAAACACGTCATCCTT
GTGGAGGATATTGTGGATACGGGAAACACATTGGCGAGTTTGATTAGAGAGTTGGAGAGGAAGGGAGCGTTTGCTGTTTCAGTTTGTGCTTTTCTTGATA
AGCCTTCGAGGCGGAAGGTCCAGTTTCAGGTCCTGGGTAGTGGCAAGTACTACCGAGGTTTTGAGTGTCCGGATTATTTTGTCGTGGGGTATGGAATGGA
CTTTGCTGAACTATACAGGAATCTGCCTTATGTTGGTGTCCTGAAGCCTGAGTTCTACAGTTGA
AA sequence
>Lus10024262 pacid=23175760 polypeptide=Lus10024262 locus=Lus10024262.g ID=Lus10024262.BGIv1.0 annot-version=v1.0
MALDSHIDKVLWSAVQISDRVASLAAEIAADFSPDSPAPVLVGVATGAFIFLADLAREIKLPISVDFIRADSYGSGTESSGAPRVSLDLKLDVKGKHVIL
VEDIVDTGNTLASLIRELERKGAFAVSVCAFLDKPSRRKVQFQVLGSGKYYRGFECPDYFVVGYGMDFAELYRNLPYVGVLKPEFYS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G71750 HGPT Hypoxanthine-guanine phosphori... Lus10024262 0 1
Lus10018751 6.0 0.7516
AT1G03220 Eukaryotic aspartyl protease f... Lus10041224 6.2 0.7953
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10014044 8.1 0.7787
AT5G44450 methyltransferases (.1) Lus10042846 23.7 0.6474
AT3G06778 Chaperone DnaJ-domain superfam... Lus10037711 25.7 0.7078
Lus10010342 26.6 0.7497
AT2G36010 E2F_DP ATE2FA, E2F3 E2F transcription factor 3 (.1... Lus10021298 39.1 0.7408
Lus10002271 44.8 0.6765
AT5G57880 MPS1, ATPRD2 ARABIDOPSIS THALIANA PUTATIVE ... Lus10010784 58.2 0.7340
AT1G68460 ATIPT1 Arabidopsis thaliana isopenten... Lus10041440 70.2 0.6896

Lus10024262 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.