Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46330 51 / 2e-10 ATAGP16, AGP16 arabinogalactan protein 16 (.1.2) AT3G61640 50 / 6e-10 AGP20, ATAGP20 arabinogalactan protein 20 (.1) AT5G53250 47 / 8e-09 AGP22, ATAGP22 arabinogalactan protein 22 (.1) AT5G24105 45 / 2e-08 AGP41 arabinogalactan protein 41 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023629 [exp] 125 / 4e-40 AT2G46330 51 / 2e-10 arabinogalactan protein 16 (.1.2) Lus10037436 [exp] 100 / 8e-30 AT5G53250 51 / 2e-10 arabinogalactan protein 22 (.1) Lus10041273 [exp] 95 / 1e-27 AT3G61640 51 / 3e-10 arabinogalactan protein 20 (.1) Lus10000542 [exp] 42 / 9e-07 AT2G46330 63 / 6e-15 arabinogalactan protein 16 (.1.2) Lus10032355 [exp] 37 / 0.0002 AT3G61640 60 / 9e-13 arabinogalactan protein 20 (.1) Lus10033939 [exp] 36 / 0.0006 AT3G61640 61 / 4e-13 arabinogalactan protein 20 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G078801 [exp] 84 / 2e-23 ND / Potri.014G094800 [exp] 48 / 5e-09 AT3G61640 42 / 1e-06 arabinogalactan protein 20 (.1) Potri.012G032000 [exp] 45 / 4e-08 AT3G61640 66 / 3e-16 arabinogalactan protein 20 (.1) Potri.003G136600 [exp] 44 / 1e-07 AT5G53250 55 / 7e-12 arabinogalactan protein 22 (.1) Potri.001G094700 [exp] 44 / 2e-07 AT2G46330 57 / 7e-13 arabinogalactan protein 16 (.1.2) Potri.015G022600 [exp] 43 / 2e-07 AT5G53250 70 / 4e-18 arabinogalactan protein 22 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06376 [flax] [poplar] AGP Arabinogalactan peptide
Representative CDS sequence Show only first row Show all	>Lus10024263 pacid=23175786 polypeptide=Lus10024263 locus=Lus10024263.g ID=Lus10024263.BGIv1.0 annot-version=v1.0 ATGAGTTCCATGAAACTGTACGGCGCTCCGATCATCGGGTTCCTAATCTTAGCTCTTGCCCAGCTTGGTTATGGACAAGAAGGCTTAGCTCCTTCTCCTG CTGTCCAAGGTCCATCCAGCAATGATGGGGCGACAATTGATCAAGGAATTGCTTACCTTCTTCTCTTGGTGGCGCTTTCCATCACATACTTGATTCATTG A
AA sequence Show only first row Show all	>Lus10024263 pacid=23175786 polypeptide=Lus10024263 locus=Lus10024263.g ID=Lus10024263.BGIv1.0 annot-version=v1.0 MSSMKLYGAPIIGFLILALAQLGYGQEGLAPSPAVQGPSSNDGATIDQGIAYLLLLVALSITYLIH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G46330		ATAGP16, AGP16	arabinogalactan protein 16 (.1...		Lus10024263 [exp]	0	1
AT5G58380		PKS2, CIPK10, S...	SNF1-RELATED PROTEIN KINASE 3....		Lus10014163 [exp]	1.4	0.9666
AT5G39670			Calcium-binding EF-hand family...		Lus10042369 [exp]	1.7	0.9467
AT2G17080			Arabidopsis protein of unknown...		Lus10012368 [exp]	2.4	0.9368
AT5G48290			Heavy metal transport/detoxifi...		Lus10025181 [exp]	2.4	0.9625
AT4G33780			unknown protein		Lus10037250 [exp]	2.6	0.9312
AT5G60920		COB	COBRA-like extracellular glyco...		Lus10017861 [exp]	3.5	0.9245
AT5G48290			Heavy metal transport/detoxifi...		Lus10016061 [exp]	4.5	0.9407
AT1G53400			Ubiquitin domain-containing pr...		Lus10029264 [exp]	4.5	0.9012
AT4G33920			Protein phosphatase 2C family ...		Lus10002110 [exp]	4.5	0.9373
AT1G70670		AtCLO4	Arabidopsis thaliana caleosin ...		Lus10041446 [exp]	5.1	0.9236

Compare expression of checked genes

Lus10024263 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.