Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51030 162 / 4e-53 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT1G45145 154 / 1e-49 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT5G42980 152 / 6e-49 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G19730 139 / 6e-44 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT5G39950 110 / 2e-32 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G59730 106 / 9e-31 ATH7 thioredoxin H-type 7 (.1) AT3G08710 98 / 4e-27 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) AT3G56420 97 / 9e-27 Thioredoxin superfamily protein (.1) AT3G17880 100 / 4e-26 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT1G69880 92 / 6e-25 ATH8 thioredoxin H-type 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000802 [exp] 233 / 1e-80 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10041799 [exp] 158 / 3e-51 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10028349 [exp] 155 / 6e-50 AT3G51030 179 / 1e-59 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10014277 [exp] 151 / 2e-48 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10025979 [exp] 131 / 9e-41 AT3G51030 167 / 3e-55 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10037228 [exp] 116 / 2e-34 AT1G59730 128 / 6e-39 thioredoxin H-type 7 (.1) Lus10037227 [exp] 115 / 8e-34 AT1G59730 129 / 3e-39 thioredoxin H-type 7 (.1) Lus10036696 [exp] 115 / 1e-33 AT1G59730 127 / 2e-38 thioredoxin H-type 7 (.1) Lus10036695 [exp] 111 / 4e-32 AT5G39950 125 / 1e-37 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G018000 [exp] 160 / 5e-52 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 158 / 2e-51 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.005G232700 [exp] 153 / 3e-49 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.012G045000 [exp] 123 / 3e-35 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.015G036000 [exp] 121 / 6e-34 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.008G194100 [exp] 107 / 1e-30 AT1G59730 119 / 3e-35 thioredoxin H-type 7 (.1) Potri.017G076700 [exp] 105 / 4e-30 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Potri.006G110100 [exp] 105 / 4e-30 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.016G138800 [exp] 103 / 3e-29 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.019G062000 [exp] 100 / 5e-28 AT3G08710 164 / 6e-53 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10024293 pacid=23175005 polypeptide=Lus10024293 locus=Lus10024293.g ID=Lus10024293.BGIv1.0 annot-version=v1.0 ATGGCGGAAGAAGGTCAGGTGATTAGCTGCACTAGCGTCGAAATGTGGAAGGAGAAGTTTGATCATGCTTCAGAGTCTAAGAAACTGGCTGTGGTGGATT TCACTGCTACGTGGTGCGGACCTTGCCGCTTCATAGCTCCAGTCCTCGCAGAATTGGCCAAGAAGATGCCTCACGTGATTTTCATGAAGGTCGATGTGGA TGAATTGAGGACTGTTGCTGCGGAGTATGAAGTCGAAGCTATGCCGACGTTCATCTTCTTCAAGGAGGGGAAGATTGTGGACAAGGTAATTGGTGCGAGG AAGGATGAACTGATTGCCGGCGTTGAGAAGCACGCAGGAACTCCCCCGGTTGTTTCTACTGCTTGA
AA sequence Show only first row Show all	>Lus10024293 pacid=23175005 polypeptide=Lus10024293 locus=Lus10024293.g ID=Lus10024293.BGIv1.0 annot-version=v1.0 MAEEGQVISCTSVEMWKEKFDHASESKKLAVVDFTATWCGPCRFIAPVLAELAKKMPHVIFMKVDVDELRTVAAEYEVEAMPTFIFFKEGKIVDKVIGAR KDELIAGVEKHAGTPPVVSTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Lus10024293 [exp]	0	1
AT5G17680			disease resistance protein (TI...		Lus10010223 [exp]	3.3	0.8072
AT4G35230		BSK1	BR-signaling kinase 1 (.1)		Lus10003329 [exp]	4.5	0.8058
AT4G31270	Trihelix		sequence-specific DNA binding ...		Lus10020182 [exp]	5.7	0.7948
					Lus10033126 [exp]	6.2	0.7976
AT4G24380			unknown protein		Lus10020946 [exp]	6.7	0.7719
AT1G13340			Regulator of Vps4 activity in ...		Lus10034303 [exp]	8.4	0.7699
AT4G13200			unknown protein		Lus10022803 [exp]	9.2	0.7813
AT3G55740		ATPROT2, ProT2	proline transporter 2 (.1.2)		Lus10028251 [exp]	9.5	0.7846
AT4G35000		APX3	ascorbate peroxidase 3 (.1)		Lus10014128 [exp]	9.9	0.7693
					Lus10023285 [exp]	12.0	0.7661

Compare expression of checked genes

Lus10024293 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.