Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09850 84 / 8e-20 XBCP3 xylem bark cysteine peptidase 3 (.1) AT3G19390 46 / 1e-06 Granulin repeat cysteine protease family protein (.1) AT5G43060 44 / 7e-06 Granulin repeat cysteine protease family protein (.1) AT1G47128 39 / 0.0003 RD21A, RD21 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006130 [exp] 147 / 3e-43 AT1G09850 535 / 0.0 xylem bark cysteine peptidase 3 (.1) Lus10024801 [exp] 43 / 2e-05 AT1G47128 633 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) Lus10018735 [exp] 43 / 2e-05 AT1G47128 491 / 3e-172 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) Lus10013204 [exp] 38 / 0.0009 AT1G20850 509 / 0.0 xylem cysteine peptidase 2 (.1) Lus10030722 [exp] 38 / 0.001 AT4G35350 511 / 0.0 xylem cysteine peptidase 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G232900 [exp] 102 / 2e-26 AT1G09850 594 / 0.0 xylem bark cysteine peptidase 3 (.1) Potri.004G057700 [exp] 42 / 3e-05 AT1G09850 362 / 4e-121 xylem bark cysteine peptidase 3 (.1) Potri.011G066800 [exp] 40 / 0.0002 AT1G09850 359 / 7e-120 xylem bark cysteine peptidase 3 (.1) Potri.014G024100 [exp] 39 / 0.0003 AT5G43060 646 / 0.0 Granulin repeat cysteine protease family protein (.1) Potri.011G066900 [exp] 39 / 0.0005 AT1G09850 366 / 7e-123 xylem bark cysteine peptidase 3 (.1) Potri.009G098100 [exp] 39 / 0.0006 AT1G47128 607 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) Potri.005G256000 [exp] 38 / 0.0008 AT1G20850 539 / 0.0 xylem cysteine peptidase 2 (.1) Potri.002G005700 [exp] 38 / 0.0009 AT1G20850 531 / 0.0 xylem cysteine peptidase 2 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024295 pacid=23174953 polypeptide=Lus10024295 locus=Lus10024295.g ID=Lus10024295.BGIv1.0 annot-version=v1.0 ATGGCTCGAAACACTGGGAATTCTCAAGGGGTCTGTGGGATTAACATGCTGGCTTCGTACCCGGAGAAGAAGGACCAAACCCACCAGCCCCACCACCACC TGGACCGAACAAGTGTGATCTCTTCACCAGCTGGCTGCAGGGGAAACTTGCTGCTGTACATTCCGATTTCTGGGCTTCTGTTTCAGGTGGAAATGCTGCG AGATGAACTCTGCAGTTTCTGCAATGATAAACATCACTGCTGCTCCCAGGACTATCCAGTGTGCGACACAACTAGAAATTTATGTCTCAAAACAATGGGG AATGGCACGATCATGCAAGCTGTTGATGCGAAAAGGTCTTCTAAACTAGGGAGTTGGAGCACAATGATGGAGGCTTGGATTATGTAG
AA sequence Show only first row Show all	>Lus10024295 pacid=23174953 polypeptide=Lus10024295 locus=Lus10024295.g ID=Lus10024295.BGIv1.0 annot-version=v1.0 MARNTGNSQGVCGINMLASYPEKKDQTHQPHHHLDRTSVISSPAGCRGNLLLYIPISGLLFQVEMLRDELCSFCNDKHHCCSQDYPVCDTTRNLCLKTMG NGTIMQAVDAKRSSKLGSWSTMMEAWIM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G09850		XBCP3	xylem bark cysteine peptidase ...		Lus10024295 [exp]	0	1
AT3G23770			O-Glycosyl hydrolases family 1...		Lus10023226 [exp]	4.2	0.9129
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Lus10023850 [exp]	6.5	0.9019
AT1G55325		MAB2, GCT	MACCHI-BOU 2, GRAND CENTRAL, R...		Lus10035972 [exp]	12.0	0.8697
					Lus10039025 [exp]	12.2	0.8862
AT2G39530			Uncharacterised protein family...		Lus10031303 [exp]	14.8	0.8857
AT3G15150		HPY2, ATMMS21	HIGH PLOIDY2, A. THALIANA METH...		Lus10015968 [exp]	16.4	0.8736
AT2G37640		ATHEXPALPHA1.9,...	ARABIDOPSIS THALIANA EXPANSIN ...		Lus10002638 [exp]	17.3	0.8734
AT2G31730	bHLH		basic helix-loop-helix (bHLH) ...		Lus10041649 [exp]	17.3	0.8861
AT3G25940			TFIIB zinc-binding protein (.1...		Lus10015458 [exp]	25.0	0.8717
					Lus10031873 [exp]	26.3	0.8675

Compare expression of checked genes

Lus10024295 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.