Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09850 66 / 5e-14 XBCP3 xylem bark cysteine peptidase 3 (.1) AT4G35350 56 / 2e-10 XCP1 xylem cysteine peptidase 1 (.1.2) AT5G43060 55 / 4e-10 Granulin repeat cysteine protease family protein (.1) AT1G06260 53 / 1e-09 Cysteine proteinases superfamily protein (.1) AT1G20850 50 / 2e-08 XCP2 xylem cysteine peptidase 2 (.1) AT1G47128 50 / 3e-08 RD21A, RD21 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) AT4G23520 49 / 4e-08 Cysteine proteinases superfamily protein (.1) AT4G36880 49 / 6e-08 CP1 cysteine proteinase1 (.1) AT4G39090 47 / 4e-07 EMB3005, RD19A, RD19 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) AT5G45890 45 / 9e-07 SAG12 senescence-associated gene 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006130 [exp] 107 / 6e-29 AT1G09850 535 / 0.0 xylem bark cysteine peptidase 3 (.1) Lus10013204 [exp] 61 / 4e-12 AT1G20850 509 / 0.0 xylem cysteine peptidase 2 (.1) Lus10030722 [exp] 60 / 6e-12 AT4G35350 511 / 0.0 xylem cysteine peptidase 1 (.1.2) Lus10015286 [exp] 54 / 1e-09 AT5G45890 393 / 7e-137 senescence-associated gene 12 (.1) Lus10025409 [exp] 53 / 2e-09 AT5G45890 304 / 2e-102 senescence-associated gene 12 (.1) Lus10025410 [exp] 52 / 3e-09 AT5G45890 382 / 2e-132 senescence-associated gene 12 (.1) Lus10002184 [exp] 52 / 3e-09 AT1G06260 384 / 1e-133 Cysteine proteinases superfamily protein (.1) Lus10015285 [exp] 52 / 4e-09 AT5G45890 406 / 8e-143 senescence-associated gene 12 (.1) Lus10003275 [exp] 52 / 5e-09 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G232900 [exp] 76 / 1e-17 AT1G09850 594 / 0.0 xylem bark cysteine peptidase 3 (.1) Potri.004G207600 [exp] 61 / 4e-12 AT4G35350 543 / 0.0 xylem cysteine peptidase 1 (.1.2) Potri.005G256000 [exp] 56 / 2e-10 AT1G20850 539 / 0.0 xylem cysteine peptidase 2 (.1) Potri.002G005700 [exp] 55 / 4e-10 AT1G20850 531 / 0.0 xylem cysteine peptidase 2 (.1) Potri.013G126100 [exp] 54 / 1e-09 AT5G45890 386 / 2e-134 senescence-associated gene 12 (.1) Potri.013G118200 [exp] 52 / 3e-09 AT5G45890 387 / 2e-135 senescence-associated gene 12 (.1) Potri.011G064900 [exp] 50 / 1e-08 AT5G45890 401 / 3e-140 senescence-associated gene 12 (.1) Potri.014G024100 [exp] 50 / 2e-08 AT5G43060 646 / 0.0 Granulin repeat cysteine protease family protein (.1) Potri.013G118400 [exp] 50 / 2e-08 AT5G45890 378 / 2e-131 senescence-associated gene 12 (.1) Potri.015G087400 [exp] 48 / 1e-07 AT5G50260 550 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [flax] [poplar] Peptidase_CA PF00112 [flax] [poplar] Peptidase_C1 Papain family cysteine protease
Representative CDS sequence Show only first row Show all	>Lus10024296 pacid=23174890 polypeptide=Lus10024296 locus=Lus10024296.g ID=Lus10024296.BGIv1.0 annot-version=v1.0 ATGGCTAGCGTGTCAAGTTTTGAACGGCCAGCTGATTGCTACGAGCGTGGAGGGAACACGGCAGATCGTATCGTTCCCAGGAAGAAAGGTCGTACAGATC TCACTCACCTTGAGTTTAAATCCTCCCGGCTAGGCCTCTCCCCAGCTTTCAAATCCAATTGCCGGAGAGTTGTCAGTCTCGTCGGAGATGTCCCGGCCAC GGTGGATTGGAGGCAGCAAGGCGCTGTCACCAATGTCAAAGACCAAGGGAGCTGCGGTGCGTCCTTTTTTGTAATGGGGAGATTTTAG
AA sequence Show only first row Show all	>Lus10024296 pacid=23174890 polypeptide=Lus10024296 locus=Lus10024296.g ID=Lus10024296.BGIv1.0 annot-version=v1.0 MASVSSFERPADCYERGGNTADRIVPRKKGRTDLTHLEFKSSRLGLSPAFKSNCRRVVSLVGDVPATVDWRQQGAVTNVKDQGSCGASFFVMGRF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G09850		XBCP3	xylem bark cysteine peptidase ...		Lus10024296 [exp]	0	1
AT4G27570			UDP-Glycosyltransferase superf...		Lus10001858 [exp]	8.9	0.8044
					Lus10025489 [exp]	10.2	0.7590
AT3G02220			unknown protein		Lus10043249 [exp]	10.9	0.8124
AT1G03430		AHP5	histidine-containing phosphotr...		Lus10042680 [exp]	13.7	0.7715
AT1G10520		AtPol{lambda}	DNA polymerase {lambda}, DNA p...		Lus10030656 [exp]	15.7	0.8027
AT3G15150		HPY2, ATMMS21	HIGH PLOIDY2, A. THALIANA METH...		Lus10015968 [exp]	25.6	0.8068
AT3G24820			BSD domain-containing protein ...		Lus10038170 [exp]	26.2	0.7459
AT2G34930			disease resistance family prot...		Lus10001035 [exp]	27.0	0.7915
AT2G31140			Peptidase S24/S26A/S26B/S26C f...		Lus10022921 [exp]	29.4	0.7898
AT4G11410			NAD(P)-binding Rossmann-fold s...		Lus10028781 [exp]	49.5	0.7237

Compare expression of checked genes

Lus10024296 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.