Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75590 152 / 3e-48 SAUR-like auxin-responsive protein family (.1) AT1G19840 147 / 2e-46 SAUR-like auxin-responsive protein family (.1) AT5G10990 145 / 8e-46 SAUR-like auxin-responsive protein family (.1) AT4G34750 100 / 9e-28 SAUR-like auxin-responsive protein family (.1.2) AT4G34760 61 / 9e-13 SAUR-like auxin-responsive protein family (.1) AT2G21220 60 / 9e-13 SAUR-like auxin-responsive protein family (.1) AT2G16580 59 / 2e-12 SAUR-like auxin-responsive protein family (.1) AT2G24400 61 / 4e-12 SAUR-like auxin-responsive protein family (.1) AT2G18010 56 / 6e-11 SAUR-like auxin-responsive protein family (.1) AT4G38860 56 / 6e-11 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012426 [exp] 251 / 1e-87 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1) Lus10034507 [exp] 179 / 5e-59 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1) Lus10033161 [exp] 170 / 2e-55 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1) Lus10026297 [exp] 91 / 3e-24 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1) Lus10042374 [exp] 90 / 6e-24 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1) Lus10012190 [exp] 84 / 2e-21 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2) Lus10021130 [exp] 61 / 1e-12 AT4G34750 97 / 8e-27 SAUR-like auxin-responsive protein family (.1.2) Lus10024326 [exp] 56 / 8e-11 AT1G75580 166 / 2e-54 SAUR-like auxin-responsive protein family (.1) Lus10012432 [exp] 54 / 4e-10 AT1G75580 164 / 9e-54 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G237000 [exp] 180 / 1e-59 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1) Potri.002G024500 [exp] 173 / 8e-57 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1) Potri.004G164300 [exp] 137 / 1e-42 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1) Potri.009G125900 [exp] 133 / 5e-41 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 57 / 2e-11 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.009G126000 [exp] 57 / 3e-11 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1) Potri.008G003900 [exp] 57 / 3e-11 AT2G24400 110 / 1e-31 SAUR-like auxin-responsive protein family (.1) Potri.005G237200 [exp] 55 / 1e-10 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1) Potri.002G024300 [exp] 54 / 2e-10 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 55 / 5e-10 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10024322 pacid=23174954 polypeptide=Lus10024322 locus=Lus10024322.g ID=Lus10024322.BGIv1.0 annot-version=v1.0 ATGTCGACCACCGGATTATCAAAGTGCGCCAAAATCCGACACATAGTTCGGCTGCGGCAAATGCTGCGGCGGTGGAGGAACAAGGCCCGTGTATCAGCCA ACAAGATTCCTTCCGACGTCCCCTCCGGCCACATCGCCGTCTGCGCCGGAATCAGCTTCCGGAGAAATCTCCTGAACCAAGCTGAAGAAGAGTTTGGATT CTCCAACCAAGGTCCCCTCACAATCCCCTGCGATGAGGCCGTTTTCGAGGAAGCAATCAGGTACATTTCCAGATCCGAGTCCGGAAAGCTCGAAGATCTC AAGAAGAGCTGCTGTCACAGACTTGGGATCCGGAGGAAGACTGATTTGTGGACCGAGTCACGGCCCCTGCTCGCTGAGAAAACCATATGGTAA
AA sequence Show only first row Show all	>Lus10024322 pacid=23174954 polypeptide=Lus10024322 locus=Lus10024322.g ID=Lus10024322.BGIv1.0 annot-version=v1.0 MSTTGLSKCAKIRHIVRLRQMLRRWRNKARVSANKIPSDVPSGHIAVCAGISFRRNLLNQAEEEFGFSNQGPLTIPCDEAVFEEAIRYISRSESGKLEDL KKSCCHRLGIRRKTDLWTESRPLLAEKTIW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G75590			SAUR-like auxin-responsive pro...		Lus10024322 [exp]	0	1
AT1G75590			SAUR-like auxin-responsive pro...		Lus10012426 [exp]	1.0	0.9171
AT3G27090			DCD (Development and Cell Deat...		Lus10012533 [exp]	4.2	0.8976
AT1G76490		HMGR1, HMG1, At...	3-HYDROXY-3-METHYLGLUTARYL COA...		Lus10026567 [exp]	4.7	0.8989
AT3G24350		ATSYP32, SYP32	syntaxin of plants 32 (.1.2)		Lus10017741 [exp]	5.9	0.8782
AT1G75780		TUB1	tubulin beta-1 chain (.1)		Lus10021094 [exp]	7.7	0.8911
AT3G19360	C3HZnF		Zinc finger (CCCH-type) family...		Lus10019431 [exp]	12.2	0.8342
AT1G66150		TMK1	transmembrane kinase 1 (.1)		Lus10003807 [exp]	13.3	0.8664
AT3G08900		RGP3	reversibly glycosylated polype...		Lus10000646 [exp]	15.3	0.8641
AT2G40620	bZIP	AtbZIP18	Basic-leucine zipper (bZIP) tr...		Lus10008605 [exp]	18.2	0.8785
AT5G36890		BGLU42	beta glucosidase 42 (.1.2)		Lus10020232 [exp]	18.3	0.8791

Compare expression of checked genes

Lus10024322 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.