Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G39705 47 / 1e-08 RTFL8, DVL11 DEVIL 11, ROTUNDIFOLIA like 8 (.1) AT3G55515 41 / 2e-06 DVL8, RTFL7 DEVIL 8, ROTUNDIFOLIA like 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007218 [exp] 118 / 5e-37 AT2G39705 42 / 2e-08 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10002705 [exp] 56 / 7e-12 AT2G39705 86 / 1e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10040784 [exp] 35 / 0.0006 AT5G59510 84 / 1e-21 DEVIL 18, ROTUNDIFOLIA like 5 (.1) Lus10023399 [exp] 0 / 1 AT2G39705 91 / 3e-25 DEVIL 11, ROTUNDIFOLIA like 8 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G057800 [exp] 60 / 7e-14 AT2G39705 84 / 8e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.010G201700 [exp] 59 / 3e-13 AT2G39705 72 / 2e-18 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.002G235101 [exp] 36 / 0.0001 AT1G53708 75 / 1e-19 ROTUNDIFOLIA like 9 (.1) Potri.001G242800 [exp] 36 / 0.0002 AT2G29125 71 / 4e-17 DEVIL 13, ROTUNDIFOLIA like 2 (.1) Potri.008G035900 [exp] 35 / 0.0002 AT2G36985 66 / 1e-16 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.010G226250 [exp] 35 / 0.0002 AT2G36985 67 / 3e-17 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.001G161200 [exp] 35 / 0.0004 AT1G53708 76 / 1e-19 ROTUNDIFOLIA like 9 (.1) Potri.003G073900 [exp] 34 / 0.001 AT1G53708 81 / 9e-22 ROTUNDIFOLIA like 9 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08137 [flax] [poplar] DVL DVL family
Representative CDS sequence Show only first row Show all	>Lus10024323 pacid=23175050 polypeptide=Lus10024323 locus=Lus10024323.g ID=Lus10024323.BGIv1.0 annot-version=v1.0 ATGAAGAATTCTTCCCAGCGGAGGTGCTCGTTCTCGAGGAAATGCGCCAGGCTTGTCAAGGAACAGCGCGCCAGGTTCTACATCATCGCAGGTGCGTCAC CATGCTCATCTGCTGGCGCGATTACAGCGATTCTTGACTCCCCGGAAGTTCTTTTAAAACGACGACCGCCGCTGGAGGCGAGGAAAGATTTCTGA
AA sequence Show only first row Show all	>Lus10024323 pacid=23175050 polypeptide=Lus10024323 locus=Lus10024323.g ID=Lus10024323.BGIv1.0 annot-version=v1.0 MKNSSQRRCSFSRKCARLVKEQRARFYIIAGASPCSSAGAITAILDSPEVLLKRRPPLEARKDF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G39705		RTFL8, DVL11	DEVIL 11, ROTUNDIFOLIA like 8 ...		Lus10024323 [exp]	0	1
AT3G18280			Bifunctional inhibitor/lipid-t...		Lus10017616 [exp]	2.4	0.8753
AT2G47470		ATPDI11, ATPDIL...	UNFERTILIZED EMBRYO SAC 5, MAT...		Lus10020691 [exp]	3.5	0.8493
AT4G33040			Thioredoxin superfamily protei...		Lus10013519 [exp]	4.0	0.8775
AT2G43060	bHLH	AtIBH1, bHLH158	ILI1 binding bHLH 1 (.1)		Lus10025511 [exp]	5.8	0.8758
AT1G20823			RING/U-box superfamily protein...		Lus10016040 [exp]	8.8	0.8609
AT2G29700		ATPH1	pleckstrin homologue 1 (.1)		Lus10040681 [exp]	8.9	0.8376
AT4G02380		SAG21, ATLEA5	Arabidopsis thaliana late embr...		Lus10029634 [exp]	13.6	0.8312
AT3G60690			SAUR-like auxin-responsive pro...		Lus10009286 [exp]	14.8	0.8635
AT4G09830			Uncharacterised conserved prot...		Lus10028692 [exp]	15.0	0.8458
AT4G38225			unknown protein		Lus10013843 [exp]	16.0	0.8637

Compare expression of checked genes

Lus10024323 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.