Lus10024338 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10024338 pacid=23175026 polypeptide=Lus10024338 locus=Lus10024338.g ID=Lus10024338.BGIv1.0 annot-version=v1.0
ATGGTTATCTCCAAGTTTATAGTATTTGCCTCTCTTCTCTTCGTCATCCAACTAGCTAATGCAGATCAGAATCAGCACCCGGCGGCCACACCGGTGGCAG
TACCCGCCCCGAACTACCCGCCGCCGAAGATTGTTAGTATTTGGGTTTCCATTAATTCGATGATTGATCAGATTGTGGGAGCGCTTGCAAGGCCAGGTGC
CAGCAATCCAGCAGGCCAAACCTTTGTCACAGAGCATGTGGTACCTGCTGTGTCCGGTGTAGTTGTGTTCCTCCCGACACTGCCGGTAACTACGACCAAT
GTCCTTGCTATGCTGGCTTGA
AA sequence
>Lus10024338 pacid=23175026 polypeptide=Lus10024338 locus=Lus10024338.g ID=Lus10024338.BGIv1.0 annot-version=v1.0
MVISKFIVFASLLFVIQLANADQNQHPAATPVAVPAPNYPPPKIVSIWVSINSMIDQIVGALARPGASNPAGQTFVTEHVVPAVSGVVVFLPTLPVTTTN
VLAMLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10024338 0 1
AT1G02000 GAE2 UDP-D-glucuronate 4-epimerase ... Lus10027195 1.7 0.8764
AT1G10550 XTH33, XET xyloglucan:xyloglucosyl transf... Lus10013000 2.0 0.8438
AT4G01575 serine protease inhibitor, Kaz... Lus10007864 3.9 0.8189
AT1G01540 Protein kinase superfamily pro... Lus10007919 6.6 0.8294
AT1G27200 Domain of unknown function (DU... Lus10036676 6.9 0.8031
AT5G40150 Peroxidase superfamily protein... Lus10039471 7.3 0.8359
AT1G75800 Pathogenesis-related thaumatin... Lus10033136 9.5 0.7885
AT5G62220 ATGT18 glycosyltransferase 18 (.1) Lus10031685 12.1 0.7965
AT4G35320 unknown protein Lus10022985 12.6 0.7945
AT1G05710 bHLH bHLH153 basic helix-loop-helix (bHLH) ... Lus10027064 14.1 0.7883

Lus10024338 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.