Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28440 86 / 3e-20 HSL1 HAESA-like 1 (.1) AT3G43740 56 / 5e-10 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) AT5G01890 52 / 2e-08 Leucine-rich receptor-like protein kinase family protein (.1) AT5G65710 52 / 2e-08 HSL2 HAESA-like 2 (.1) AT1G72180 52 / 2e-08 Leucine-rich receptor-like protein kinase family protein (.1) AT4G08850 51 / 3e-08 Leucine-rich repeat receptor-like protein kinase family protein (.1.2) AT3G05360 51 / 3e-08 AtRLP30 receptor like protein 30 (.1) AT4G28490 51 / 4e-08 RLK5, HAESA RECEPTOR-LIKE PROTEIN KINASE 5, HAESA, Leucine-rich receptor-like protein kinase family protein (.1) AT4G22730 50 / 5e-08 Leucine-rich repeat protein kinase family protein (.1) AT5G27060 50 / 5e-08 AtRLP53 receptor like protein 53 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013968 [exp] 120 / 3e-32 AT1G28440 1372 / 0.0 HAESA-like 1 (.1) Lus10015393 [exp] 116 / 6e-31 AT1G28440 1372 / 0.0 HAESA-like 1 (.1) Lus10018636 [exp] 71 / 7e-15 AT1G28440 1203 / 0.0 HAESA-like 1 (.1) Lus10039872 [exp] 70 / 1e-14 AT1G28440 942 / 0.0 HAESA-like 1 (.1) Lus10010949 [exp] 53 / 7e-09 AT3G20820 440 / 8e-155 Leucine-rich repeat (LRR) family protein (.1) Lus10031377 [exp] 52 / 1e-08 AT3G20820 433 / 3e-152 Leucine-rich repeat (LRR) family protein (.1) Lus10016342 [exp] 52 / 2e-08 AT2G34930 478 / 4e-154 disease resistance family protein / LRR family protein (.1) Lus10001035 [exp] 51 / 3e-08 AT2G34930 488 / 9e-157 disease resistance family protein / LRR family protein (.1) Lus10016384 [exp] 51 / 4e-08 AT2G34930 464 / 5e-148 disease resistance family protein / LRR family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G058100 [exp] 83 / 3e-19 AT1G28440 1309 / 0.0 HAESA-like 1 (.1) Potri.004G049100 [exp] 81 / 1e-18 AT1G28440 1387 / 0.0 HAESA-like 1 (.1) Potri.017G016600 [exp] 72 / 2e-15 AT1G28440 1130 / 0.0 HAESA-like 1 (.1) Potri.007G135400 [exp] 69 / 2e-14 AT1G28440 1109 / 0.0 HAESA-like 1 (.1) Potri.006G104300 [exp] 56 / 5e-10 AT3G51740 996 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Potri.016G126300 [exp] 53 / 6e-09 AT3G51740 1038 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Potri.015G028600 [exp] 53 / 7e-09 AT2G34930 387 / 1e-119 disease resistance family protein / LRR family protein (.1) Potri.011G104900 [exp] 53 / 9e-09 AT1G71400 362 / 2e-111 receptor like protein 12 (.1) Potri.001G262800 [exp] 52 / 1e-08 AT2G34930 429 / 8e-135 disease resistance family protein / LRR family protein (.1) Potri.019G021700 [exp] 52 / 1e-08 AT1G08590 1286 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Lus10024341 pacid=23174903 polypeptide=Lus10024341 locus=Lus10024341.g ID=Lus10024341.BGIv1.0 annot-version=v1.0 ATGTTGATTCCAGAGGAAATAGGTAGGGTCGGCAGCCTAGTGGACTTCTCCACTAACGGGAATAACCTCAGCGGCGGCGGGTTACCGGGGAGCTTGGTGA ATCTGAAGCAATTAAGTGAACTGGATCTCCACGGCAATCAACTCACCGACGAGATTCTACAAGGAATCGACTCATGGAAGAAGCTGAACGAGCTCAATTT GGGTGAGAATCGATTTTTGGGTGAAATCCCTAGCTCAATCGTGAAACTATCCGTTCTCAATTACCTCGATTTATCGGGAAACAATCTCGCCCGGCGAAAT CCCGTCCAATCTCCAGAACATGAAGCTAAATCAGATCAATTTATCCAACAACAAGCTCTCCAGGGATTCCACCTTTATACGCTAAGGAGATATTTATGA
AA sequence Show only first row Show all	>Lus10024341 pacid=23174903 polypeptide=Lus10024341 locus=Lus10024341.g ID=Lus10024341.BGIv1.0 annot-version=v1.0 MLIPEEIGRVGSLVDFSTNGNNLSGGGLPGSLVNLKQLSELDLHGNQLTDEILQGIDSWKKLNELNLGENRFLGEIPSSIVKLSVLNYLDLSGNNLARRN PVQSPEHEAKSDQFIQQQALQGFHLYTLRRYL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G28440		HSL1	HAESA-like 1 (.1)		Lus10024341 [exp]	0	1
AT2G39530			Uncharacterised protein family...		Lus10031875 [exp]	8.0	0.7572
AT5G53980	HD	ATHB52	homeobox protein 52 (.1)		Lus10003492 [exp]	12.2	0.7694
AT1G75540	CO	LHUS, AtBBX21, ...	long hypocotyl under shade, B-...		Lus10033184 [exp]	16.4	0.7662
AT4G35690			Arabidopsis protein of unknown...		Lus10028382 [exp]	16.5	0.7246
AT1G69490	NAC	NAP, ANAC029, A...	Arabidopsis NAC domain contain...		Lus10026617 [exp]	17.1	0.7427
					Lus10036026 [exp]	20.7	0.6961
AT1G11920			Pectin lyase-like superfamily ...		Lus10011257 [exp]	41.2	0.7212
AT5G57280		RID2	root initiation defective 2, S...		Lus10015533 [exp]	50.3	0.7246
AT3G53010			Domain of unknown function (DU...		Lus10042635 [exp]	74.5	0.6644
AT4G04750			Major facilitator superfamily ...		Lus10018957 [exp]	82.0	0.6734

Compare expression of checked genes

Lus10024341 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.