Lus10024349 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10024349 pacid=23174892 polypeptide=Lus10024349 locus=Lus10024349.g ID=Lus10024349.BGIv1.0 annot-version=v1.0
ATGAACTGGGTTCAAGGCATAGCGACAGTATGGGGATTGATGTTTCTGATGGGTCTGATGTGTTGCTGCCTCACCTCCAATCTTCGCCACCGCTCCGATA
TCGATAACAGCGAGACCGCTAGCTGTGCTTGTGATGGTGGCTATGCTGCTGGGAGCACATGCACGCTGAGATGGGATGCTTCAGTTCAAAACCGGCAAGG
ACCACCGCCATCACTAATGGACGGAAACACAGGCGTCATCACCATTCCGCTCATTAAAGAGGCGGCGGTACCGTTTTTTATTCGAGTGGCGGCGCAGGAT
GCGGTGGCGGAGGCGGGCATGGAGGCTGTCATGGAGGTGGTGGATGCGGCGGGGGTGGATGTGGAGGCGGAGGTGGTGGCGGGTGTCAATAAACTTCCAA
TTGATTTACTAGCTTTTCTGAGGAGGTAG
AA sequence
>Lus10024349 pacid=23174892 polypeptide=Lus10024349 locus=Lus10024349.g ID=Lus10024349.BGIv1.0 annot-version=v1.0
MNWVQGIATVWGLMFLMGLMCCCLTSNLRHRSDIDNSETASCACDGGYAAGSTCTLRWDASVQNRQGPPPSLMDGNTGVITIPLIKEAAVPFFIRVAAQD
AVAEAGMEAVMEVVDAAGVDVEAEVVAGVNKLPIDLLAFLRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10024349 0 1
AT2G03350 Protein of unknown function, D... Lus10036804 2.0 0.9822
AT1G64640 AtENODL8 early nodulin-like protein 8 (... Lus10033227 2.4 0.9816
AT1G64650 Major facilitator superfamily ... Lus10000336 2.8 0.9817
AT4G09600 GASA3 GAST1 protein homolog 3 (.1) Lus10014262 3.6 0.9571
AT5G20950 Glycosyl hydrolase family prot... Lus10043457 4.9 0.9778
AT5G40390 RS5, SIP1 seed imbibition 1-like, raffin... Lus10027679 5.7 0.9541
AT3G24450 Heavy metal transport/detoxifi... Lus10017730 5.9 0.9654
AT5G14020 Endosomal targeting BRO1-like ... Lus10031997 6.3 0.9725
AT1G11545 XTH8 xyloglucan endotransglucosylas... Lus10018365 8.9 0.9594
AT5G03960 IQD12 IQ-domain 12 (.1) Lus10018031 9.0 0.9597

Lus10024349 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.