Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37770 491 / 1e-176 ChlAKR, AKR4C9 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G37790 482 / 3e-173 AKR4C10 Aldo-keto reductase family 4 member C10, NAD(P)-linked oxidoreductase superfamily protein (.1) AT3G53880 447 / 4e-159 AKR4C11 Aldo-keto reductase family 4 member C11, NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37760 414 / 4e-146 AKR4C8 Aldo-keto reductase family 4 member C8, NAD(P)-linked oxidoreductase superfamily protein AT5G01670 267 / 3e-88 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT5G62420 255 / 1e-83 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G21250 227 / 9e-73 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G21260 223 / 2e-71 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59960 221 / 4e-70 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59950 206 / 2e-64 NAD(P)-linked oxidoreductase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012652 [exp] 557 / 0 AT2G37770 441 / 4e-155 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10010885 [exp] 487 / 6e-175 AT2G37770 502 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10021491 [exp] 456 / 2e-163 AT2G37770 464 / 2e-166 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10010884 [exp] 445 / 1e-158 AT2G37770 484 / 5e-174 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024354 [exp] 436 / 9e-152 AT2G37770 467 / 2e-163 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024350 [exp] 320 / 3e-106 AT3G53900 374 / 9e-128 PYRIMIDINE R, uracil phosphoribosyltransferase (.1.2) Lus10027216 [exp] 262 / 2e-86 AT5G62420 429 / 2e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10031162 [exp] 259 / 4e-85 AT5G62420 431 / 1e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10029208 [exp] 254 / 4e-83 AT1G59960 406 / 7e-143 NAD(P)-linked oxidoreductase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G090600 [exp] 471 / 1e-168 AT2G37770 503 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102032 [exp] 456 / 8e-163 AT2G37770 424 / 2e-150 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102100 [exp] 438 / 6e-156 AT2G37770 400 / 5e-141 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.017G070600 [exp] 418 / 8e-148 AT2G37770 438 / 6e-156 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102300 [exp] 382 / 7e-134 AT2G37770 398 / 5e-140 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.001G125400 [exp] 271 / 7e-90 AT5G62420 445 / 2e-158 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.008G193100 [exp] 249 / 3e-81 AT1G59960 420 / 3e-148 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.005G097000 [exp] 249 / 4e-81 AT1G59960 405 / 2e-142 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.008G144600 [exp] 244 / 7e-79 AT2G37770 251 / 1e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.010G097800 [exp] 241 / 1e-77 AT2G37770 250 / 3e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00248 [flax] [poplar] Aldo_ket_red Aldo/keto reductase family
Representative CDS sequence Show only first row Show all	>Lus10024353 pacid=23174940 polypeptide=Lus10024353 locus=Lus10024353.g ID=Lus10024353.BGIv1.0 annot-version=v1.0 ATGGGAAAGGAACTTCCATCCTTTAAGTTGAACACCGGAGCTAGCATCCCGGCGATTGGCCTGGGGACGTGGCAGGCCGCACCTGGTCTTGTCGGCGCCG CCGTTGAGGCTGCCATTAAGATTGGATACAGGCATATTGACTGTGCTCAAGCATACGGCAATGAGAAGGAGGTGGGAGCTGTTCTAAAGAAGCTCTTTAA CGAGGGTGTGGTCAAGCGTGAGGATCTGTTCATCACCTCCAAGCTCTGGAATGCTAATCATTCACCGGAAGATGTTCCCGTGAATCTGGAAGGAACTCTC CGTGACTTGCAGATTGACTATGTAGATTTATACCTGATTCATTGGCCGGTTAGATTCAGGAAAGGGGCAGTTGGGTCCAAGCCTGACAACGTTGTGGAAT CTGATATTCCGGCTACTTGGCGAGCCATGGAGGCTGCTTTTGATGCAGGGAAAGCTCGAGCTATTGGAGTGAGCAATTTCTCCTCCAAGAAACTTGGAGA TTTGATTGAGATTGCTCGTGTTCCTCCCGCTGTGCTCCAGGTCGAATGCCACCCTCACTGGCAACAGCCTAAGCTACATGACTTCTGCAAATCAAAAGGA GTTCATCTAACTGGATATTCACCATTGGGGTCCCCGGGCACCACATGGTTTACCATGGATGTTCTGAAGAACCCAATATTGAACATGGTTGCTGAGAAAG TAGGGAAAACTCCAGCACAAGTGGCCCTCCGCTGGGGCCTGCAAATGGGGCATAGTGTTCTCCCCAAGAGCACTAAGGAGGAAAGGATCAAGGAGAATTT GGAAGTCTTTAATTGGTCAATCCCTGATGACTTGTTCTCTAAGTTCTCTGAAATTGAGCAGGCAAGGCAGCTGAGAGGGACACAGTTCGTGAACGAGGCG GTCTGCGGGCATCACAGCATCGAGGAGATATGGGATGGAGAGCTCTGA
AA sequence Show only first row Show all	>Lus10024353 pacid=23174940 polypeptide=Lus10024353 locus=Lus10024353.g ID=Lus10024353.BGIv1.0 annot-version=v1.0 MGKELPSFKLNTGASIPAIGLGTWQAAPGLVGAAVEAAIKIGYRHIDCAQAYGNEKEVGAVLKKLFNEGVVKREDLFITSKLWNANHSPEDVPVNLEGTL RDLQIDYVDLYLIHWPVRFRKGAVGSKPDNVVESDIPATWRAMEAAFDAGKARAIGVSNFSSKKLGDLIEIARVPPAVLQVECHPHWQQPKLHDFCKSKG VHLTGYSPLGSPGTTWFTMDVLKNPILNMVAEKVGKTPAQVALRWGLQMGHSVLPKSTKEERIKENLEVFNWSIPDDLFSKFSEIEQARQLRGTQFVNEA VCGHHSIEEIWDGEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37770		ChlAKR, AKR4C9	Chloroplastic aldo-keto reduct...		Lus10024353 [exp]	0	1
AT4G12320		CYP706A6	"cytochrome P450, family 706, ...		Lus10032217 [exp]	3.5	0.8950
AT5G35970			P-loop containing nucleoside t...		Lus10024974 [exp]	3.6	0.9138
AT4G39970			Haloacid dehalogenase-like hyd...		Lus10000633 [exp]	10.6	0.9072
AT1G52510			alpha/beta-Hydrolases superfam...		Lus10035875 [exp]	13.1	0.8918
AT5G04440			Protein of unknown function (D...		Lus10038659 [exp]	13.5	0.8740
AT3G16520		UGT88A1	UDP-glucosyl transferase 88A1 ...		Lus10039301 [exp]	14.4	0.8826
AT3G18430			Calcium-binding EF-hand family...		Lus10042708 [exp]	15.9	0.8869
AT4G09350		NdhT, CRRJ	NADH dehydrogenase-like comple...		Lus10029740 [exp]	17.3	0.8876
AT2G36800		UGT73C5, DOGT1	UDP-GLUCOSYL TRANSFERASE 73C5,...		Lus10003323 [exp]	18.4	0.8783
AT4G02920			unknown protein		Lus10029640 [exp]	19.1	0.8913

Compare expression of checked genes

Lus10024353 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.