Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02090 45 / 1e-07 unknown protein AT2G37750 43 / 9e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010878 [exp] 187 / 2e-63 AT5G02090 46 / 9e-08 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G090100 [exp] 87 / 6e-24 AT5G02090 59 / 1e-12 unknown protein Potri.016G101900 [exp] 86 / 2e-23 AT2G37750 57 / 2e-12 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024357 pacid=23174958 polypeptide=Lus10024357 locus=Lus10024357.g ID=Lus10024357.BGIv1.0 annot-version=v1.0 ATGGAAGGTCTGATTCCTTTCGTGTACAGAGCATTAACCCAACACAGCAGAAACGGAAGCAGGGCCGGATCAGGTGCTCTTAATTCATGGTTCACCGATT CCCCTTCAATGTCCTACATCCGACTTCCTGGAGATTCCGGTAGGTTCCAGGCTTCCGATCATCTCCAGCTTCTGGCATCATCAGACTGCTCTACTTCCTC TGCTCCCTTCAATCTGAATTCATCCGCAGTCGTTTCCACGGGAGCTCAATCTCCGCTCTGCCGCTTCTCTCGCCGGGTGGCTGCCTGA
AA sequence Show only first row Show all	>Lus10024357 pacid=23174958 polypeptide=Lus10024357 locus=Lus10024357.g ID=Lus10024357.BGIv1.0 annot-version=v1.0 MEGLIPFVYRALTQHSRNGSRAGSGALNSWFTDSPSMSYIRLPGDSGRFQASDHLQLLASSDCSTSSAPFNLNSSAVVSTGAQSPLCRFSRRVAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02090			unknown protein		Lus10024357 [exp]	0	1
AT5G15870			glycosyl hydrolase family 81 p...		Lus10021987 [exp]	1.4	0.8849
AT5G17280			unknown protein		Lus10028356 [exp]	3.7	0.8558
AT3G15890			Protein kinase superfamily pro...		Lus10011490 [exp]	4.0	0.8793
AT2G20740			Tetraspanin family protein (.1...		Lus10039817 [exp]	5.7	0.8748
AT5G05960			Bifunctional inhibitor/lipid-t...		Lus10000397 [exp]	6.0	0.8595
AT4G00750			S-adenosyl-L-methionine-depend...		Lus10041366 [exp]	6.0	0.8766
AT5G10530			Concanavalin A-like lectin pro...		Lus10029553 [exp]	6.6	0.8606
AT1G75810			unknown protein		Lus10033134 [exp]	7.1	0.8617
AT4G27270			Quinone reductase family prote...		Lus10020076 [exp]	7.9	0.8625
AT1G05160		ATKAO1, CYP88A3	ENT-KAURENOIC ACID OXYDASE 1, ...		Lus10033105 [exp]	9.8	0.8366

Compare expression of checked genes

Lus10024357 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.