Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38870 47 / 2e-08 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT3G46860 37 / 0.0002 Serine protease inhibitor, potato inhibitor I-type family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010859 [exp] 167 / 2e-55 AT2G38900 47 / 3e-08 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2) Lus10003225 [exp] 105 / 8e-31 AT2G38900 42 / 1e-06 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2) Lus10035626 [exp] 100 / 8e-29 AT2G38900 43 / 8e-07 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2) Lus10018783 [exp] 62 / 4e-14 AT2G38870 89 / 2e-25 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10032655 [exp] 55 / 4e-10 AT1G52870 499 / 3e-176 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10043097 [exp] 54 / 7e-10 AT1G52870 505 / 2e-179 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10018784 [exp] 46 / 6e-08 AT2G38870 89 / 1e-25 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10018786 [exp] 46 / 9e-08 AT2G38870 93 / 6e-27 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10024870 [exp] 45 / 2e-07 AT2G38870 94 / 2e-27 Serine protease inhibitor, potato inhibitor I-type family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G088664 [exp] 104 / 9e-31 ND / Potri.006G088500 [exp] 103 / 9e-30 ND / Potri.006G088616 [exp] 103 / 1e-29 ND / Potri.006G088700 [exp] 96 / 4e-27 ND / Potri.011G110100 [exp] 52 / 3e-10 AT5G43580 78 / 1e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.011G110400 [exp] 52 / 4e-10 AT5G43580 78 / 1e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075600 [exp] 51 / 8e-10 AT5G43580 80 / 3e-21 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.009G028300 [exp] 48 / 9e-09 AT5G43580 76 / 7e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075200 [exp] 48 / 1e-08 AT2G38870 76 / 4e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.005G221000 [exp] 46 / 7e-08 AT5G43580 74 / 5e-19 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0367 [flax] [poplar] CI-2 PF00280 [flax] [poplar] potato_inhibit Potato inhibitor I family
Representative CDS sequence Show only first row Show all	>Lus10024370 pacid=23175042 polypeptide=Lus10024370 locus=Lus10024370.g ID=Lus10024370.BGIv1.0 annot-version=v1.0 ATGGCGGAAGAAAACCAGCAGACGTCCAAGGAACAGCCCACAGAACCTCTGCCAAGATCTTACGGGATGGACATTGGGGTGCCTAGTAACAATACTTCTT CGAAAGTGGAGTGGCCGGAGTTAGTCGGCGTGACGGCGGAGGAAGCTGAATCCAAGATCAAGCAAGAAGCAATGGAAGGACTTCAAGTCCATGTGATTCC AGCTAATAGCTTTGTCACCATGGATTTTCGCCAGGACAGGGTCCGGTTATTTGTCGACGCTGACGGCAAAATCGCCAGAGCCCCTAGAATTGGCTGA
AA sequence Show only first row Show all	>Lus10024370 pacid=23175042 polypeptide=Lus10024370 locus=Lus10024370.g ID=Lus10024370.BGIv1.0 annot-version=v1.0 MAEENQQTSKEQPTEPLPRSYGMDIGVPSNNTSSKVEWPELVGVTAEEAESKIKQEAMEGLQVHVIPANSFVTMDFRQDRVRLFVDADGKIARAPRIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38870			Serine protease inhibitor, pot...		Lus10024370 [exp]	0	1
AT1G49320		ATUSPL1	unknown seed protein like 1 (....		Lus10007011 [exp]	1.0	0.7687
AT5G43080		CYCA3;1	Cyclin A3;1 (.1)		Lus10013886 [exp]	16.6	0.7571
AT3G56960		PIP5K4	phosphatidyl inositol monophos...		Lus10010458 [exp]	17.3	0.6846
AT3G50330	bHLH	HEC2, bHLH037	HECATE 2, basic helix-loop-hel...		Lus10042647 [exp]	26.3	0.7500
AT3G19300			Protein kinase superfamily pro...		Lus10019844 [exp]	61.2	0.7088
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10028654 [exp]	82.6	0.6242
AT3G61610			Galactose mutarotase-like supe...		Lus10010131 [exp]	100.2	0.6659
AT2G40220	AP2_ERF	ATABI4, GIN6, S...	SUCROSE UNCOUPLED 6, SUGAR-INS...		Lus10040944 [exp]	128.9	0.6356
AT4G26910			Dihydrolipoamide succinyltrans...		Lus10043117 [exp]	154.0	0.6211

Compare expression of checked genes

Lus10024370 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.