Lus10024373 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G02160 110 / 7e-32 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010856 0 / 1 AT5G59550 120 / 3e-29 zinc finger (C3HC4-type RING finger) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G087701 126 / 3e-38 AT5G02160 101 / 2e-28 unknown protein
PFAM info
Representative CDS sequence
>Lus10024373 pacid=23174901 polypeptide=Lus10024373 locus=Lus10024373.g ID=Lus10024373.BGIv1.0 annot-version=v1.0
ATGGCAACTCTTTCTGCTCTGCAAACTTTCTGCACAGGAAATTCACCTCACAGAGTTGATCATCTTCGAGGATGCAGCAGCTCTTCCGCAACACCAACTT
GGAGTTCAATCTCCAAGAAGAAGAAGAGCATGAGATCATCATTGACTGTGGTGGCAGCCGTCGGAGATGTCTCCCCTGACGGCACAGTCTACCTCCTCGC
CGGCGCCGCCACCATCGCTCTGCTTGGGACTGCCTTGCCTGCATTCTTCTCTCGCAAAGACACTTGCCCGGAGTGCGACGGGGCAGGTTTCGTACGGAAA
TCGGCGGCGACCTTGAGAGCAAATGCTGCAAGGAAGGATCAGGCTCAGATAGTTTGCCAGAATTGCAATGGGCTAGGCAAGCTCAACCAAGTCGACAAAT
GA
AA sequence
>Lus10024373 pacid=23174901 polypeptide=Lus10024373 locus=Lus10024373.g ID=Lus10024373.BGIv1.0 annot-version=v1.0
MATLSALQTFCTGNSPHRVDHLRGCSSSSATPTWSSISKKKKSMRSSLTVVAAVGDVSPDGTVYLLAGAATIALLGTALPAFFSRKDTCPECDGAGFVRK
SAATLRANAARKDQAQIVCQNCNGLGKLNQVDK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G02160 unknown protein Lus10024373 0 1
AT3G27690 LHCB2.3, LHCB2:... LIGHT-HARVESTING CHLOROPHYLL B... Lus10001741 1.4 0.9484
AT4G09010 TL29, APX4 thylakoid lumen 29, ascorbate ... Lus10008718 2.0 0.9453
AT3G10060 FKBP-like peptidyl-prolyl cis-... Lus10035560 4.4 0.9085
AT4G09010 TL29, APX4 thylakoid lumen 29, ascorbate ... Lus10020942 5.5 0.9412
AT4G09040 RNA-binding (RRM/RBD/RNP motif... Lus10008721 6.7 0.9299
AT1G07700 Thioredoxin superfamily protei... Lus10024726 10.6 0.9295
AT5G44520 NagB/RpiA/CoA transferase-like... Lus10008059 10.6 0.9318
AT3G08940 LHCB4.2 light harvesting complex photo... Lus10027786 11.2 0.9143
AT5G67385 Phototropic-responsive NPH3 fa... Lus10019290 11.7 0.9271
AT1G55370 NDF5 NDH-dependent cyclic electron ... Lus10002626 11.7 0.8991

Lus10024373 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.