Lus10024379 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10024379 pacid=23174951 polypeptide=Lus10024379 locus=Lus10024379.g ID=Lus10024379.BGIv1.0 annot-version=v1.0
ATGATCGAGCTTTGGTCCCGTCGCCCGTGTGAGATTGACTTTGTGGAGACAAAACGTGCAGAGAAGGGGTTGGGTCATTTGGTTTCATACTTTGTCTTGG
TTGGGGCGATGCGGAGCCCAACTCGCTCCGTCACCTACATTTACCCACCTACTGTGATGGCGATGGCGATGGAGCACAGTATAGCTTGGGTGCTGAATTG
TGAATCATCAGCAGGTGCTTATGACAATCCCACGGCCACAAAGTGA
AA sequence
>Lus10024379 pacid=23174951 polypeptide=Lus10024379 locus=Lus10024379.g ID=Lus10024379.BGIv1.0 annot-version=v1.0
MIELWSRRPCEIDFVETKRAEKGLGHLVSYFVLVGAMRSPTRSVTYIYPPTVMAMAMEHSIAWVLNCESSAGAYDNPTATK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10024379 0 1
Lus10011832 3.2 1.0000
AT2G20420 ATP citrate lyase (ACL) family... Lus10022902 4.5 1.0000
AT1G08510 FATB fatty acyl-ACP thioesterases B... Lus10025763 5.7 1.0000
Lus10027689 6.0 1.0000
Lus10027991 11.0 1.0000
Lus10009727 12.0 1.0000
AT4G19540 INDH, INDL IND1(iron-sulfur protein requi... Lus10011951 14.9 1.0000
AT2G23540 GDSL-like Lipase/Acylhydrolase... Lus10005236 16.0 1.0000
Lus10003536 16.4 1.0000
Lus10011642 16.6 1.0000

Lus10024379 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.