Lus10024390 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G02280 263 / 3e-92 SNARE-like superfamily protein (.1)
AT1G51160 61 / 2e-12 SNARE-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010836 291 / 2e-103 AT5G02280 259 / 2e-90 SNARE-like superfamily protein (.1)
Lus10023793 269 / 1e-94 AT5G02280 261 / 2e-91 SNARE-like superfamily protein (.1)
Lus10039298 68 / 6e-15 AT1G51160 323 / 5e-115 SNARE-like superfamily protein (.1.2)
Lus10027541 68 / 6e-15 AT1G51160 323 / 5e-115 SNARE-like superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G069800 273 / 2e-96 AT5G02280 267 / 1e-93 SNARE-like superfamily protein (.1)
Potri.017G149900 65 / 1e-13 AT1G51160 332 / 2e-118 SNARE-like superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF04099 Sybindin Sybindin-like family
Representative CDS sequence
>Lus10024390 pacid=23174993 polypeptide=Lus10024390 locus=Lus10024390.g ID=Lus10024390.BGIv1.0 annot-version=v1.0
ATGGCTGCCATTTACAGCCTCTACATCATCAACAAATCCGGTGGCTTGATCTTCTACAAGGATTATGGATCTTCTGGTAGAATGGATACGAACGACAGCT
TGCGAGTGGCTAGTTTGTGGCACTCGATGCACGCCATTTCTCAGCAGTTATCCCCAATTGTTGGCTGTTCGGGCATTGAGCTCCTTGAAGCCGATAATTT
TGACCTCCATTGCTTCCAATCCCTTACAGGGACAAAGTTCTTTGTTGTATCCGAGCCAGGAACGCTGTACATGGAGAATCTGTTGAAGTACATCTACGAG
CAGTATACAGATTACGTGTTGAAAAACCCTTTCTATGAGATGGAGATGCCTATCAGATGCGAGCTCTTTGACATCAATATGTCTCAGGCTATACAGAAGG
ATCGTGTTGCTCTGTTGGGTCGATGA
AA sequence
>Lus10024390 pacid=23174993 polypeptide=Lus10024390 locus=Lus10024390.g ID=Lus10024390.BGIv1.0 annot-version=v1.0
MAAIYSLYIINKSGGLIFYKDYGSSGRMDTNDSLRVASLWHSMHAISQQLSPIVGCSGIELLEADNFDLHCFQSLTGTKFFVVSEPGTLYMENLLKYIYE
QYTDYVLKNPFYEMEMPIRCELFDINMSQAIQKDRVALLGR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G02280 SNARE-like superfamily protein... Lus10024390 0 1
AT4G35410 Clathrin adaptor complex small... Lus10003641 2.0 0.8533
AT5G13710 CPH, SMT1 CEPHALOPOD, sterol methyltrans... Lus10039600 2.0 0.8486
AT5G58030 Transport protein particle (TR... Lus10003634 3.0 0.8304
AT5G13710 CPH, SMT1 CEPHALOPOD, sterol methyltrans... Lus10029498 3.5 0.8071
AT5G66410 PLP3B phosducin-like protein 3 homol... Lus10025176 6.6 0.8258
AT5G20110 Dynein light chain type 1 fami... Lus10030069 16.6 0.8087
AT4G22330 ATCES1 Alkaline phytoceramidase (aPHC... Lus10043146 18.8 0.7407
AT2G07340 PFD1 PREFOLDIN 1 (.1.2) Lus10021609 20.1 0.7541
AT5G17620 unknown protein Lus10013643 23.0 0.7922
AT2G36410 Family of unknown function (DU... Lus10035563 23.5 0.8065

Lus10024390 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.