Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025350 [exp] 67 / 3e-16 AT5G02380 51 / 3e-10 metallothionein 2B (.1) Lus10025349 [exp] 66 / 2e-14 AT5G02370 536 / 0.0 ATP binding microtubule motor family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01439 [flax] [poplar] Metallothio_2 Metallothionein
Representative CDS sequence Show only first row Show all	>Lus10024396 pacid=23174886 polypeptide=Lus10024396 locus=Lus10024396.g ID=Lus10024396.BGIv1.0 annot-version=v1.0 ATGTCTTCGTCTTGCTGCGGAGGAAACTGTGGATGCGGCGCCGGATGCAAGTGCGGCACCAGCTGTGGAGGATGCAAGATGTATCCAGACGTCGAGTGGA GCGCCGCCACCGAGACAGTGGTCCTGGGAGTGGCGCCGGGGAATGCTAGCTTCGAGAGCGCGTCTGAGTCCGGCGAGAATGGAGGGTGCAAATGCGGCGA CAAGTGCACCTGCGATCCCTGCACCTGTAAATGA
AA sequence Show only first row Show all	>Lus10024396 pacid=23174886 polypeptide=Lus10024396 locus=Lus10024396.g ID=Lus10024396.BGIv1.0 annot-version=v1.0 MSSSCCGGNCGCGAGCKCGTSCGGCKMYPDVEWSAATETVVLGVAPGNASFESASESGENGGCKCGDKCTCDPCTCK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02380		MT2B	metallothionein 2B (.1)		Lus10024396 [exp]	0	1
AT3G25545			unknown protein		Lus10029095 [exp]	2.4	0.7448
AT4G25780			CAP (Cysteine-rich secretory p...		Lus10006981 [exp]	4.5	0.7387
AT2G44050		COS1	coronatine insensitive1 suppre...		Lus10018133 [exp]	7.0	0.6938
AT1G16740			Ribosomal protein L20 (.1)		Lus10006327 [exp]	14.3	0.7142
AT1G64520		RPN12A	regulatory particle non-ATPase...		Lus10023053 [exp]	15.9	0.6692
AT1G30440			Phototropic-responsive NPH3 fa...		Lus10023274 [exp]	16.2	0.6980
AT5G04940		SUVH1	SU(VAR)3-9 homolog 1 (.1), SU(...		Lus10008680 [exp]	17.4	0.6888
AT3G02520		GENERALREGULATO...	general regulatory factor 7 (....		Lus10017584 [exp]	18.3	0.7069
AT5G55940		EMB2731	embryo defective 2731, Unchara...		Lus10016647 [exp]	26.3	0.6446
AT2G31410			unknown protein		Lus10031995 [exp]	27.9	0.7182

Compare expression of checked genes

Lus10024396 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.