Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53740 161 / 7e-53 Ribosomal protein L36e family protein (.1.2.3.4) AT5G02450 157 / 2e-51 Ribosomal protein L36e family protein (.1) AT2G37600 156 / 9e-51 Ribosomal protein L36e family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025342 [exp] 213 / 4e-73 AT3G53740 161 / 9e-53 Ribosomal protein L36e family protein (.1.2.3.4) Lus10016466 [exp] 211 / 1e-72 AT3G53740 160 / 2e-52 Ribosomal protein L36e family protein (.1.2.3.4) Lus10016501 [exp] 213 / 2e-72 AT3G53740 160 / 9e-52 Ribosomal protein L36e family protein (.1.2.3.4) Lus10040728 [exp] 209 / 9e-72 AT3G53740 159 / 5e-52 Ribosomal protein L36e family protein (.1.2.3.4) Lus10040766 [exp] 214 / 3e-70 AT3G53740 162 / 2e-49 Ribosomal protein L36e family protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G066000 [exp] 182 / 3e-61 AT3G53740 173 / 2e-57 Ribosomal protein L36e family protein (.1.2.3.4) Potri.004G057000 [exp] 180 / 3e-60 AT2G37600 172 / 2e-57 Ribosomal protein L36e family protein (.1.2) Potri.015G145800 [exp] 177 / 2e-59 AT3G53740 173 / 1e-57 Ribosomal protein L36e family protein (.1.2.3.4) Potri.012G142600 [exp] 177 / 2e-59 AT3G53740 173 / 1e-57 Ribosomal protein L36e family protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01158 [flax] [poplar] Ribosomal_L36e Ribosomal protein L36e
Representative CDS sequence Show only first row Show all	>Lus10024402 pacid=23174914 polypeptide=Lus10024402 locus=Lus10024402.g ID=Lus10024402.BGIv1.0 annot-version=v1.0 ATGGCTCCTGCTCAGGCGAAGAGTGGTCTGTTCGTCGGACTGAACAAAGGACACATCGTCACTAAGCGCGAGCTGCCACCTCGTCCTTCCGATAGAAAGG GGAAAACAAGCAAGAGGGTGCACCTTGTGAGGAACCTTATCAGGGAAGTAGCTGGTTTTGCTCCATATGAGAAGAGAGTTATTGAGCTCCTGAAGGTTGG AAAGGACAAGCGAGCTCTGAAACTTTCTAAGAGAAAGCTCGGTACCCACAAGAGGGGCAAGAAGAAGAGAGAGGAGCTGGCCACCGCACTCCGCAAGATG AGGGCTGCAGGAGGAGGCGAGAAGAAGAAGTGA
AA sequence Show only first row Show all	>Lus10024402 pacid=23174914 polypeptide=Lus10024402 locus=Lus10024402.g ID=Lus10024402.BGIv1.0 annot-version=v1.0 MAPAQAKSGLFVGLNKGHIVTKRELPPRPSDRKGKTSKRVHLVRNLIREVAGFAPYEKRVIELLKVGKDKRALKLSKRKLGTHKRGKKKREELATALRKM RAAGGGEKKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53740			Ribosomal protein L36e family ...		Lus10024402 [exp]	0	1
AT3G11940		AML1, ATRPS5A	ARABIDOPSIS MINUTE-LIKE 1, rib...		Lus10008436 [exp]	1.4	0.9824
AT5G10920			L-Aspartase-like family protei...		Lus10002606 [exp]	2.2	0.9732
AT3G62870			Ribosomal protein L7Ae/L30e/S1...		Lus10010763 [exp]	2.4	0.9753
AT3G62870			Ribosomal protein L7Ae/L30e/S1...		Lus10015841 [exp]	2.4	0.9810
AT3G17465		RPL3P	ribosomal protein L3 plastid (...		Lus10017709 [exp]	3.5	0.9681
AT2G42740		RPL16A	ribosomal protein large subuni...		Lus10020715 [exp]	4.2	0.9716
AT1G76010			Alba DNA/RNA-binding protein (...		Lus10034549 [exp]	5.7	0.9561
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10023454 [exp]	6.3	0.9712
AT1G48830			Ribosomal protein S7e family p...		Lus10028789 [exp]	6.3	0.9709
AT1G09590			Translation protein SH3-like f...		Lus10030607 [exp]	6.5	0.9714

Compare expression of checked genes

Lus10024402 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.