Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37530 73 / 1e-17 unknown protein AT1G07795 59 / 5e-12 unknown protein AT2G28725 57 / 1e-11 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025320 [exp] 156 / 2e-50 AT2G37530 99 / 5e-28 unknown protein Lus10023761 [exp] 89 / 7e-24 AT1G07795 89 / 5e-24 unknown protein Lus10005894 [exp] 54 / 3e-10 AT1G07795 97 / 5e-27 unknown protein Lus10040852 [exp] 54 / 4e-10 AT1G07795 97 / 4e-27 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G083800 [exp] 92 / 2e-25 AT2G37530 93 / 1e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024416 pacid=23174910 polypeptide=Lus10024416 locus=Lus10024416.g ID=Lus10024416.BGIv1.0 annot-version=v1.0 ATGTCTCTTTCTTCCTTCGCCTCTCTCCGCCGGCGGCTGTTGCCCAAGCTGCCTCTCCTAATCTATGCCACCACGTGGACCAGTCTCCTTACCGTGATCG TAGCTGTGGCCTCGTTCTCGCCGGAGTTTGCCTTTGTATCCACTGTTACGCAAGTTCAGTCTCCGGATTCAGGAGACTGTAGAAGGGAAGGAATGGTTAG AGTTCCGTTGGACGTTCCTGGAGAAGTGTTTTGCTTGCCAGCTCGGCTATTTGTCAAGTCAGACATTGACTTCCTAGTTCCGCCAGCGTTCGCTGCTGTC GTTGTGGCAGGGGCCGCTTGGGTGGTTCGGTCCATTGCGTTGTGGGAAGTGGAGGAAGAGACCGGTTAA
AA sequence Show only first row Show all	>Lus10024416 pacid=23174910 polypeptide=Lus10024416 locus=Lus10024416.g ID=Lus10024416.BGIv1.0 annot-version=v1.0 MSLSSFASLRRRLLPKLPLLIYATTWTSLLTVIVAVASFSPEFAFVSTVTQVQSPDSGDCRREGMVRVPLDVPGEVFCLPARLFVKSDIDFLVPPAFAAV VVAGAAWVVRSIALWEVEEETG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37530			unknown protein		Lus10024416 [exp]	0	1
AT2G16750			Protein kinase protein with ad...		Lus10014122 [exp]	2.0	0.9546
AT3G11780			MD-2-related lipid recognition...		Lus10021256 [exp]	2.0	0.9565
AT5G10280	MYB	ATMYB92, AtMYB6...	myb domain protein 92 (.1)		Lus10036472 [exp]	4.2	0.9519
AT1G79700	AP2_ERF		Integrase-type DNA-binding sup...		Lus10005513 [exp]	4.8	0.9328
AT4G02050		STP7	sugar transporter protein 7 (....		Lus10019070 [exp]	7.5	0.9134
AT1G16060	AP2_ERF	ADAP	ARIA-interacting double AP2 do...		Lus10001553 [exp]	7.7	0.9384
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10022066 [exp]	7.7	0.9479
AT5G12380		ANNAT8	annexin 8 (.1)		Lus10019780 [exp]	7.7	0.9370
AT1G52155			unknown protein		Lus10038269 [exp]	8.5	0.9358
AT3G24570			Peroxisomal membrane 22 kDa (M...		Lus10022130 [exp]	8.9	0.9402

Compare expression of checked genes

Lus10024416 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.