Lus10024418 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59890 250 / 4e-87 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2)
AT3G46010 248 / 2e-86 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2)
AT5G59880 248 / 2e-86 ADF3 actin depolymerizing factor 3 (.1.2)
AT3G46000 246 / 2e-85 ADF2 actin depolymerizing factor 2 (.1)
AT4G00680 235 / 4e-81 ADF8 actin depolymerizing factor 8 (.1)
AT1G01750 234 / 9e-81 ADF11 actin depolymerizing factor 11 (.1)
AT4G25590 232 / 4e-80 ADF7 actin depolymerizing factor 7 (.1)
AT5G52360 223 / 1e-76 ADF10 actin depolymerizing factor 10 (.1)
AT2G31200 193 / 2e-64 ADF6, ATADF6 actin depolymerizing factor 6 (.1)
AT4G34970 186 / 1e-61 ADF9 actin depolymerizing factor 9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024417 280 / 8e-99 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2)
Lus10025319 280 / 8e-99 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2)
Lus10023428 250 / 5e-84 AT5G59890 244 / 4e-81 actin depolymerizing factor 4 (.1.2)
Lus10040307 246 / 3e-83 AT5G59890 243 / 2e-81 actin depolymerizing factor 4 (.1.2)
Lus10027474 223 / 3e-76 AT5G52360 244 / 6e-85 actin depolymerizing factor 10 (.1)
Lus10038859 216 / 7e-74 AT4G25590 232 / 2e-80 actin depolymerizing factor 7 (.1)
Lus10014977 216 / 1e-73 AT4G25590 233 / 1e-80 actin depolymerizing factor 7 (.1)
Lus10039229 210 / 2e-71 AT5G52360 231 / 6e-80 actin depolymerizing factor 10 (.1)
Lus10022933 195 / 3e-65 AT2G31200 254 / 9e-89 actin depolymerizing factor 6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G236700 265 / 6e-93 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2)
Potri.009G028100 260 / 3e-91 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2)
Potri.009G028200 258 / 2e-90 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2)
Potri.010G208500 257 / 6e-90 AT5G59890 255 / 4e-89 actin depolymerizing factor 4 (.1.2)
Potri.001G236400 255 / 3e-89 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2)
Potri.008G052100 255 / 3e-89 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2)
Potri.015G144500 240 / 2e-83 AT4G25590 257 / 6e-90 actin depolymerizing factor 7 (.1)
Potri.012G141600 239 / 8e-83 AT4G25590 254 / 5e-89 actin depolymerizing factor 7 (.1)
Potri.001G106200 236 / 2e-81 AT4G00680 234 / 6e-81 actin depolymerizing factor 8 (.1)
Potri.003G125500 231 / 1e-79 AT4G00680 234 / 1e-80 actin depolymerizing factor 8 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0092 ADF PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence
>Lus10024418 pacid=23174907 polypeptide=Lus10024418 locus=Lus10024418.g ID=Lus10024418.BGIv1.0 annot-version=v1.0
ATGGCGAATGCAGCGTCTGGATTTGCAGTTGATGATGACTGCAAACTGAAGTTCCTGGAGCTGAAGGCAAAAAGAACCTACCGCTTCATAGTTTTCAAGA
TCGAGGAGAAGCAAAAGCAAGTCATTGTGGAGAAACTTGGTGAGCCAGGCGAAAGCTACGATGATTTTGCTGCTAGCCTCCCTGCCGACGAGTGCCGCTA
TGCTGTATTTGATTTTGACTTCGTCACCAAGGAGAACTGCCAGAAGAGCAGAATATTTTTCATCGCATGGTCTCCTGATACATCAAGGGTGAGAAGCAAG
ATGATCTACGCCAGCTCAAAGGACAGATTCAAGAGAGAGCTTGACGGAATCCAGGTCGAATTGCAAGCAACTGATCCAACTGAGATGGGGCTTGACGTGT
TCAAAAGCCGTGCCAACTGA
AA sequence
>Lus10024418 pacid=23174907 polypeptide=Lus10024418 locus=Lus10024418.g ID=Lus10024418.BGIv1.0 annot-version=v1.0
MANAASGFAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPGESYDDFAASLPADECRYAVFDFDFVTKENCQKSRIFFIAWSPDTSRVRSK
MIYASSKDRFKRELDGIQVELQATDPTEMGLDVFKSRAN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G59890 ADF4, ATADF4 actin depolymerizing factor 4 ... Lus10024418 0 1
AT3G46010 ATADF1, ADF1 actin depolymerizing factor 1 ... Lus10024417 1.0 0.9095
AT4G32530 ATPase, F0/V0 complex, subunit... Lus10000694 2.0 0.9034
AT4G16695 unknown protein Lus10007491 2.6 0.8456
AT5G64020 TBL14 TRICHOME BIREFRINGENCE-LIKE 14... Lus10037877 4.0 0.8826
AT3G13410 unknown protein Lus10010298 4.5 0.8473
AT4G29340 PRF4 profilin 4 (.1) Lus10034988 4.6 0.8895
AT1G68100 IAR1 IAA-ALANINE RESISTANT 1, ZIP m... Lus10042480 5.5 0.8407
AT1G48440 B-cell receptor-associated 31-... Lus10001080 6.9 0.8465
AT5G19440 NAD(P)-binding Rossmann-fold s... Lus10002300 7.3 0.8408
AT2G45200 ATGOS12, GOS12 golgi snare 12 (.1.2) Lus10001986 8.0 0.7996

Lus10024418 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.